KEGG   Roseiflexus castenholzii: Rcas_3124Help
Entry
Rcas_3124         CDS       T00585                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rca  Roseiflexus castenholzii
Brite
Enzymes [BR:rca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Rcas_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4045516..4046361)
Genome map
AA seq 281 aa AA seqDB search
MPTESIQFAARATESPSVGRRRVESLTVWAGSPGVLLIHGFGGDLAEVRPLAAAFIREGY
SVHAPLLPGHGALPDALAGVRWQQWAETVVQGFALLHQHCSEVAVVGFSMGSLLALLLAA
HLPVARLVALAPALTLRGQFLVNLSSIARYAISWYYPLARADFKDPALRALIRNRVPDAD
LDDPVVCEQLRRTVRMPLTAIHQLTLLQRSARRALPRITAPTLVVQGRDDATVDPRSAGQ
VARHIGAADCRLIWMDGYGHQLLLGEGGERVAHMIVAWLKG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaatcgatccaatttgctgcgcgtgcgacagaatcaccatcggttggacgt
cgcagggtggagtcgctgactgtttgggcgggttcgccgggtgtattgttgatccatggc
tttggcggcgatctggcggaagtccgtccactggcggctgcattcattcgggagggatac
agcgtgcacgccccgctgctccctggtcatggcgcgcttcccgatgcgcttgccggtgtc
cggtggcaacaatgggcggaaacagtggtgcagggatttgcgctgctgcatcagcattgc
tccgaggttgcggtcgttggcttttcgatgggatcgttgctcgcgctgctgctggcggca
catctgccggttgcgcgcctggtcgcgctggcgccggcgttgacgctgcgcggccaattt
ctggtgaatctgagcagtatcgcgcgatacgccatttcatggtactatcctcttgccagg
gctgatttcaaagatccggcgctgcgcgcgcttatacgcaatcgcgtcccggatgccgat
cttgatgacccggtcgtctgtgagcaattgcgccgcactgtgcgcatgccgctgactgcg
attcatcagttgaccctgttgcagcgctctgcgcgccgtgcattgccgcgcatcacggcg
ccaacgctggtagtgcaggggcgcgatgatgcaacagtcgatccacgatccgccgggcag
gtcgcgcggcatatcggtgctgccgactgtcggttgatttggatggatgggtatggacat
cagttgctcctcggcgagggtggtgaacgggtcgcgcatatgatcgtcgcctggctcaaa
gggtag

DBGET integrated database retrieval system