KEGG   Roseiflexus castenholzii: Rcas_3180Help
Entry
Rcas_3180         CDS       T00585                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rca  Roseiflexus castenholzii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rcas_3180
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rcas_3180
Enzymes [BR:rca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rcas_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4128955..4130049
Genome map
AA seq 364 aa AA seqDB search
MNDASVQHELTRLTCNLIAFPSTADHPDALIAAIDYVEQYARDSGIQFIHRFEVEQKPSL
MITLRDTQRPALILNGHLDVVAARAEQYQPVVRDGRIYGRGSQDMKGACAVLMRLIRDLA
ALPDPPDVGFMFVTDEEIGGFHGTNYLLEHGWRSAFFIAAEPTDLNICYAAKGMVRFDIT
LHGQPAHGSRPWEGVNPILLLRDGLQALEQRFPTPREAVWATTAVPTVVRGGDTLNRIPE
VVTLSLDIRHIPEETPDEIEAAVRACFPGATVARNSTGGIPLMTDPNDPHLAQLAASIER
IIGRQPVFYREHYGSDARFYSGAGIPAICFGPVGAGLHSDHEWVDIASLERLYLILRDVA
TAAE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgcctcagtacagcacgaactgacccgcctgacctgtaacctgattgcgttc
ccttcgaccgccgaccatcccgatgcactgatcgccgcaattgattatgtcgagcagtac
gctcgtgattcgggcatccagtttattcaccgtttcgaagtcgaacagaagcccagcctg
atgatcaccctgcgcgacacgcaaaggccagcgctcatcctcaacggtcacctcgatgtg
gtcgccgcgcgcgctgaacagtatcaaccggtcgtgcgcgacggacggatctacggacgc
ggcagccaggacatgaaaggcgcgtgcgccgttcttatgcgcctgatacgcgatctggct
gcgcttccggatccacccgacgttgggtttatgtttgtcaccgatgaagaaatcggcggg
ttccatggcaccaactacctgctggaacacgggtggcgctctgcgttcttcatcgctgcc
gagccgaccgatctgaacatctgctatgccgccaagggcatggtgcgcttcgacatcacc
ttgcacggacaaccggcgcacggttcgcgcccgtgggaaggggttaatccgatccttctg
ctgcgcgacgggttacaggcgctcgaacaacgcttcccaacgccgcgcgaagcagtgtgg
gcaacaaccgccgtccctaccgtggttcgtggcggtgatacactcaaccgcattccagag
gtggtgacgctttcactcgacattcgccacattcctgaagaaaccccagacgagatcgag
gcggcggtgcgcgcctgcttccccggcgcaacggttgcgcgcaacagcacaggcggcatc
ccgctgatgaccgaccccaacgatccgcacctggcgcagttggctgccagcattgagcgc
atcatcgggcgtcaaccggtcttctaccgtgagcactatggctcagatgcgcgcttctat
agcggcgcgggcattccggcaatctgctttggaccggtgggcgcagggctgcactctgat
catgaatgggtggatatcgccagcctggagcgcctgtatctgatcctgcgcgatgttgcg
acggcagccgagtga

DBGET integrated database retrieval system