KEGG   Roseiflexus castenholzii: Rcas_3186Help
Entry
Rcas_3186         CDS       T00585                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00260  Glycine, serine and threonine metabolism
rca00750  Vitamin B6 metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01230  Biosynthesis of amino acids
Module
rca_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rcas_3186
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rcas_3186
Enzymes [BR:rca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rcas_3186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABU59240
JGI: Rcas3186
UniProt: A7NNU6
Position
4142639..4143679
Genome map
AA seq 346 aa AA seqDB search
MLFDRYGAFLPLTEQTPRLSLGEGDTPLIHAPRLARAIGVRELFLKYEGANPTGSFKDRG
MVVAVAKALEAGATSVICASTGNTSASAAAYAAHAGIESIVVVPAGKIALGKLAQALMYG
ARLLVIEGNFDQALHIVRDLAQTYPVTIVNSVNPYRLEGQATAAYEICDALGGPPDALCL
PVGNAGNITAYWMGFRRYHEAGRIDRLPRMLGFQAEGAAPIVRGHPVEHPETIATAIRIG
NPASWCYALDARDQSGGLIDWVSDDQILQSWRDLARLEGVFVEPASAAGIAGLRRVIAEG
RAEPNARYVAVLTGHGLKDPGLAVEQFDVPEPTPADMDAILRWLGW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcgaccgctatggcgcatttctgccgctcacggagcaaacgccgcgcctcagc
cttggcgaaggcgatacgccattgatccacgcgccgcgcctggcgcgcgccattggggta
cgcgagttgtttctgaaatatgagggcgccaacccgaccggctcgttcaaggatcgcggc
atggtcgtagccgtcgccaaagccctcgaagcgggcgcaacctcggtgatctgcgcttcg
accggcaacacctccgccagtgcggcggcgtatgcggcgcatgccgggattgagtcgatc
gtcgtggtgcctgccggaaaaattgcgcttggcaaactggcgcaggcgctgatgtacggc
gcgcggctgctggtgatcgagggcaacttcgaccaggcgttgcacatagtgcgcgacctg
gcgcagacgtatccggtcaccattgtcaactcggtgaacccctaccgccttgaagggcag
gcaaccgccgcctacgaaatctgcgatgcactcggcggtccgccagacgcgctctgcctg
ccggtcggcaacgccgggaacatcactgcgtactggatggggttccgtcgctatcacgag
gcggggcgcatcgaccgattgccgagaatgctcggtttccaggcggaaggcgctgcaccg
attgtgcgcgggcatccggtcgaacacccggaaaccatcgcaaccgcgatccgcatcggc
aacccggccagttggtgctacgcactcgatgcgcgcgatcagtcgggcgggttgatcgac
tgggtgagcgatgatcagattctccaaagctggcgtgatctggcgcgcctggaaggggtg
ttcgtcgaaccggcatcggcagccggcatcgccgggttgcgcagagtcatcgccgaagga
cgcgccgaaccgaatgcgcgctatgtggcggtgctcaccggtcatggactgaaagacccg
gggctggcggttgaacaattcgatgttcctgagccgacgccggcggacatggacgccatt
cttcgatggttgggctggtag

DBGET integrated database retrieval system