KEGG   Roseiflexus castenholzii: Rcas_3224Help
Entry
Rcas_3224         CDS       T00585                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rcas_3224
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_3224
  Lipid metabolism
   00071 Fatty acid degradation
    Rcas_3224
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rcas_3224
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rcas_3224
   00626 Naphthalene degradation
    Rcas_3224
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rcas_3224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4194917..4195870)
Genome map
AA seq 317 aa AA seqDB search
MHALVYDGKLRQVDDYPRPVLRAGEALIRPTLVGICNTDIEITRGYMNFRGVLGHEFVGV
VVACEDAAWIGQRVVGEINAACRDCAVCRRGDESHCPNRTTLGIDRRDGAMAELFSLPIA
CLHRAPDRMPDAVAVFTEPVAAALEMLQQIHLRPTDQVAVVGDGKLGLLCVQAARLPGCD
VTLVGRHPERWEFLESMAIHAIHVDELDAAYTARFDVVVDCTGHPHGFRVARRLVRPRGS
LVMKSTFAAESECNLTMLVVDEIRLIGSRCGPFAAALRALDGGLIATAPLIAARFPLHDG
LRAFAAAAGRLKVLLEV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacttgtgtatgatggcaaactgcgtcaggtcgacgattatccccgaccagtt
ctgcgtgctggcgaggcgctcattcgccccacgctggttggcatctgcaacaccgatatt
gaaatcacccgcggctatatgaactttcgcggcgtgctggggcacgaattcgttggcgtt
gtcgtcgcttgtgaggacgcggcgtggatcggacagcgtgtggtcggcgaaatcaatgcg
gcatgccgcgattgtgccgtatgtcggcgcggcgacgagagccattgccccaatcgcacc
acgcttggcattgatcggcgggacggcgcaatggcggaattgttcagcctgccgatagcc
tgtcttcatcgggcgccggatcgtatgccggatgccgtggcagtgttcaccgaaccggtc
gctgccgcgctcgaaatgcttcagcaaattcatctgcgcccgaccgatcaggttgcggtg
gttggtgatggcaaactcggtctgctctgtgtgcaggcggcgcgccttcctggatgcgat
gtcacgctggttgggcggcatccagagcgttgggagtttctggagagcatggcgattcac
gccatccatgttgacgaattggacgcagcgtataccgcgcgcttcgatgtggttgtcgat
tgcaccggtcatccgcacggatttcgagtggcgcgccgattggtgcgcccgcgcgggtct
ctggtgatgaagagcacattcgcagccgagtcggagtgcaacctgaccatgctggtggtg
gacgagattcgcctgatcgggtcgcgttgcggtccgtttgcagcggcgctgcgcgcgctc
gacggcgggttgatcgcaacggcgccattgatcgctgcgcggtttccgctccacgatggc
ttgcgcgcattcgccgccgcagccggtcggttgaaagtgttgctggaggtgtag

DBGET integrated database retrieval system