KEGG   Roseiflexus castenholzii DSM13941: Rcas_3268Help
Entry
Rcas_3268         CDS       T00585                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rca00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rca00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rca02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4242288..4243862
Genome map
AA seq 524 aa AA seqDB search
MFGGKRTLGLIGTIALLIATVSAVAAGTEIPELRGSSRTGNVIFIHPDGSGINHWAAARI
YWYGPDALSPWDTLPEMAAYRGHMADILTGTSNGGATTHAFGYKVEGLGSFGKDGDGDAA
RSILALSSYPGSIMREAINHGHPVALVNDGDIAEPGTAAFVSEVGNRNLDNEIVRQILDG
RPGFEGEQPPHIILAGGERFFLPAGTPQCAPEAVTLDCYVHRDPITGAGPSREDGRNLLR
EFEAKGYVIVRTRAEFEALRERVNSDRRYAPNVLGLFAADDIFNDVPEERLISAGLVDPS
IDVNDKRTNLILFGSQPGTLGYNPPTAAEMTDLALTIIQRCARQAGKPFMMVVETESVDN
FGNNDNAIGTLTGLKHANDVIEAAQRFQQRNRNTLILTAADSDAGGMQVGAWNPNQNVAG
YNNNPTGVSAQNVSSPLDGRYGRNSPPFLSEPDAYGKRMAFAVSWVGTPDVSGGILSRAQ
GLNSAELRRTFRGRFDNTDVYRLMYLTLFGTALPSSIGQTAPNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaggaaaacgcacgctcggtctgatcggcacaatcgcgctgctgatcgcaacg
gtttctgcggtagcagcaggtacggagattcctgaactgcggggttcatcacgcacgggc
aacgtcatctttatccatcccgacggctctggcatcaaccattgggctgccgctcgcatc
tactggtacggtcccgatgcgctgagcccctgggatacgctgcccgagatggctgcctat
cggggtcacatggcagacatcctgaccggcacctcgaatggtggcgcgaccacgcacgct
ttcggttacaaggtcgaagggcttggctcattcggcaaagacggcgatggtgatgccgca
cgcagcattctggcgctttccagctatccgggcagcatcatgcgcgaggcgatcaaccat
ggtcacccggtggcactcgtgaacgacggcgatatcgccgagccgggcacagccgccttt
gtctctgaagttggcaaccgcaacctcgacaatgagatcgttcgccagatcctcgatggt
cgtccgggcttcgaaggtgagcagccgccgcacatcattctggctggcggtgagcggttc
tttctgccggctggtacgccgcagtgcgctccagaggctgtcactctcgactgctatgtg
caccgtgacccgatcaccggcgctggtccaagccgcgaggacgggcgcaacctgctcagg
gagttcgaggcgaagggatatgtgattgtgcgcacccgcgccgagttcgaggcactgcgc
gagcgggtgaatagcgatcgccgctacgcgcctaatgtgctcggactgtttgctgctgac
gacattttcaatgatgtgcccgaggaacgcctgatcagcgcaggtctggtcgatccttcc
atcgacgtcaacgacaagcgcacgaacctgatcctcttcggcagccaacccggtacactg
gggtataacccgccaactgccgctgagatgaccgatctcgcactgacgattatccagcgt
tgcgcgcggcaggctggcaagccgtttatgatggtggttgaaacggagagcgtggacaac
ttcggcaacaacgacaacgccattggcacgctcaccggtctgaagcacgccaatgatgtc
atcgaggcggcgcagcggttccagcagcgcaatcgcaatacgctgatcctgaccgccgcc
gacagcgacgctggcggtatgcaggtcggtgcatggaatccgaaccagaatgtggcgggg
tataacaacaacccaaccggagtgagtgcgcaaaatgtgtcctcgccgctcgatggtcgc
tatggacgcaactcaccgccgttcctgagcgagcccgatgcctatggcaagcggatggca
ttcgcggttagctgggtgggcacgcctgacgtgtcgggcggcattctctcgcgcgctcag
gggttgaactctgctgaattgcggcgcacgtttcgcggtcgtttcgataacaccgatgtg
taccgcctgatgtacctgaccctcttcggcacggcgctgccgtcgtcgatcggtcaaacg
gcgccgaaccggtag

DBGET integrated database retrieval system