KEGG   Roseiflexus castenholzii: Rcas_3330Help
Entry
Rcas_3330         CDS       T00585                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00010  Glycolysis / Gluconeogenesis
rca00260  Glycine, serine and threonine metabolism
rca00680  Methane metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01200  Carbon metabolism
rca01230  Biosynthesis of amino acids
Module
rca_M00002  Glycolysis, core module involving three-carbon compounds
rca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_3330
  Energy metabolism
   00680 Methane metabolism
    Rcas_3330
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rcas_3330
Enzymes [BR:rca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rcas_3330
Membrane trafficking [BR:rca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rcas_3330
Exosome [BR:rca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rcas_3330
  Exosomal proteins of melanoma cells
   Rcas_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABU59380
JGI: Rcas3330
UniProt: A7NP84
Position
4346693..4347220
Genome map
AA seq 175 aa AA seqDB search
MLTELFLIRHAEPDRATGLPYAVLPGPPLTLRGEEEAVQAGHWLRERGIERLLSSPFTRA
SVTATTIGQLIGLEPTLIETLREVAPGETHPEVRARIAGLIDQLDDTSLQRVALVTHGSC
ILAALQHTTNDRIDLSGHRYDYGNHTPTAGIWHGVRTEHGWRWSLAFYPGRATES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgactgaactgtttttgatccgccacgccgaaccggatcgtgcgactggtctgccc
tatgccgttttgccaggaccgccgttgacgctgcgcggcgaggaggaagcggtgcaggcg
gggcactggctgcgcgagcgcggtatcgagcggttgctctcgtcaccgttcacccgcgcc
agtgttaccgctaccaccattgggcaactcattggattggaaccgaccctgatcgagacc
ttacgtgaggtggcgccgggggaaacacatccagaagtgcgcgcccgtatcgccgggctg
atcgatcaacttgacgatacatcgttgcagcgcgtcgcgctcgtcactcatggcagttgc
attcttgccgctctccagcatacaacgaatgatcgcatcgatttgagcgggcatcgctac
gactatgggaatcacacaccaacggcgggcatctggcatggagttcgcaccgaacacggc
tggcgctggtcgctggcgttttatcctggaagagccaccgaaagttga

DBGET integrated database retrieval system