KEGG   Roseiflexus castenholzii DSM13941: Rcas_3330Help
Entry
Rcas_3330         CDS       T00585                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rca01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rca00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:rca00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rca00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4346693..4347220
Genome map
AA seq 175 aa AA seqDB search
MLTELFLIRHAEPDRATGLPYAVLPGPPLTLRGEEEAVQAGHWLRERGIERLLSSPFTRA
SVTATTIGQLIGLEPTLIETLREVAPGETHPEVRARIAGLIDQLDDTSLQRVALVTHGSC
ILAALQHTTNDRIDLSGHRYDYGNHTPTAGIWHGVRTEHGWRWSLAFYPGRATES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgactgaactgtttttgatccgccacgccgaaccggatcgtgcgactggtctgccc
tatgccgttttgccaggaccgccgttgacgctgcgcggcgaggaggaagcggtgcaggcg
gggcactggctgcgcgagcgcggtatcgagcggttgctctcgtcaccgttcacccgcgcc
agtgttaccgctaccaccattgggcaactcattggattggaaccgaccctgatcgagacc
ttacgtgaggtggcgccgggggaaacacatccagaagtgcgcgcccgtatcgccgggctg
atcgatcaacttgacgatacatcgttgcagcgcgtcgcgctcgtcactcatggcagttgc
attcttgccgctctccagcatacaacgaatgatcgcatcgatttgagcgggcatcgctac
gactatgggaatcacacaccaacggcgggcatctggcatggagttcgcaccgaacacggc
tggcgctggtcgctggcgttttatcctggaagagccaccgaaagttga

DBGET integrated database retrieval system