KEGG   Roseiflexus castenholzii: Rcas_3330Help
Entry
Rcas_3330         CDS       T00585                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_3330
   01230 Biosynthesis of amino acids
    Rcas_3330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_3330
  Energy metabolism
   00680 Methane metabolism
    Rcas_3330
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rcas_3330
Enzymes [BR:rca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rcas_3330
Exosome [BR:rca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rcas_3330
  Exosomal proteins of melanoma cells
   Rcas_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4346693..4347220
Genome map
AA seq 175 aa AA seqDB search
MLTELFLIRHAEPDRATGLPYAVLPGPPLTLRGEEEAVQAGHWLRERGIERLLSSPFTRA
SVTATTIGQLIGLEPTLIETLREVAPGETHPEVRARIAGLIDQLDDTSLQRVALVTHGSC
ILAALQHTTNDRIDLSGHRYDYGNHTPTAGIWHGVRTEHGWRWSLAFYPGRATES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgactgaactgtttttgatccgccacgccgaaccggatcgtgcgactggtctgccc
tatgccgttttgccaggaccgccgttgacgctgcgcggcgaggaggaagcggtgcaggcg
gggcactggctgcgcgagcgcggtatcgagcggttgctctcgtcaccgttcacccgcgcc
agtgttaccgctaccaccattgggcaactcattggattggaaccgaccctgatcgagacc
ttacgtgaggtggcgccgggggaaacacatccagaagtgcgcgcccgtatcgccgggctg
atcgatcaacttgacgatacatcgttgcagcgcgtcgcgctcgtcactcatggcagttgc
attcttgccgctctccagcatacaacgaatgatcgcatcgatttgagcgggcatcgctac
gactatgggaatcacacaccaacggcgggcatctggcatggagttcgcaccgaacacggc
tggcgctggtcgctggcgttttatcctggaagagccaccgaaagttga

DBGET integrated database retrieval system