KEGG   Roseiflexus castenholzii: Rcas_3563Help
Entry
Rcas_3563         CDS       T00585                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rca  Roseiflexus castenholzii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rcas_3563
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rcas_3563
   00600 Sphingolipid metabolism
    Rcas_3563
Enzymes [BR:rca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rcas_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4651600..4653654
Genome map
AA seq 684 aa AA seqDB search
MTIPATLDHSTAGLVCLLRLIPHIGLMRLGLAHESWALDSSALFAAVIDGQLFDAQTPGA
QVRHVSESETPPGMRHVCVELAYADSGIVVAYHIVTYADSAALETWIVVQNEGDVPRRVT
RLDSLALDLPPDGYHLCAFTGAWGAEFEPQRMILNSAITLESRSGRSSHGHHPWFTLVRN
GRSLMSGMIAWSGNWVIRFTPKLDGALALSGGLHNWEFAVDLAPGASVAAPPVTLAFATG
ADLDETAVQFARLGRQFWYPRNALADALPVEWNHWWAYEDRALDEATFRANVDVAARLGI
EVCTLDAGWFGAPDADTHWYEQRGDWDRVNTARFPSGIRALADDVHAHGMRFGIWCEIEG
LGIHAQLAERHPEFIAMRDGERLGYVCLGNPAAQQWAFETLDRLVRENGCDWIKLDFNLN
PGAGCNRTDHGHGAEDGLYAHYRGYYALLDRLRATHPEVVLENCSSGGLRIDPGIARRTH
MAFLSDPDWPEHSLQVFWGATCMLAPDACLHWGYSEWAFAEHPSQTFNPCDPALQPHQVD
CYTRISMLRRFGFSQRLPDLPEWVAQRYAEHIQFYKTVMRRFVREADMYRLTGQPLGEGR
GDRWAGFQYRMPDGNEHLIAIFRLPGGEPSRALRLKHLQPDRVYTLSWIDTGHRAQMNGA
TLMDAGLHVENLPEEGSAIVLIHG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccccgccacgctcgatcactccactgctggacttgtctgcctgctgcgtctt
attccacacatcgggctgatgcgtctcgggctggcgcatgagtcgtgggcgttggattca
tcggcgctctttgcggcagtgattgatggacaattgttcgatgcacagacaccgggcgcc
caggtgcggcatgtgtcagagtctgaaacgccgcctggcatgcgccacgtgtgtgttgaa
ctggcatatgccgattccgggatcgtcgttgcgtatcatatcgtaacctatgccgatagt
gcggcgttggagacatggatcgtcgtgcagaatgagggagacgtaccgcgtcgcgtgacc
cgtctggactcgctggcgctcgatcttcctcccgatggataccatctctgcgcctttacc
ggcgcatggggcgcagagttcgagccgcagcgcatgatcctcaatagcgccatcaccctg
gaaagccggtctggacgctcatcgcacggccatcatccctggtttacgcttgtgcgcaat
ggtcgctcgctgatgtccggcatgattgcgtggtcgggcaactgggtgatccgtttcacg
ccaaagctggatggcgctctcgcgctgtcgggcgggttgcacaactgggaattcgccgtc
gatcttgcgccgggcgcatcggtcgcggcgccgccggtgacactggcgttcgcaacaggc
gccgatctcgatgagacggcggttcagtttgcgcgtttgggacggcagttctggtatccg
cgcaatgcgctggcggatgcgctgccggtcgagtggaaccactggtgggcatacgaagac
cgcgcactcgatgaggcgaccttccgcgccaatgtcgatgtcgcggcgcgcctgggcatc
gaggtatgcaccctcgacgccggatggttcggtgcgccggacgccgatacgcactggtac
gaacaacgcggcgactgggatagggtcaatactgcgcgcttcccgtccggcattcgcgca
cttgccgatgatgtccacgcgcatggcatgcgtttcggcatctggtgcgaaattgagggg
cttggcatccacgcgcaactggcagagcggcatcctgaattcatcgccatgcgcgacggt
gaacgccttgggtacgtctgccttggcaatccggcggcgcagcagtgggcattcgagacg
ctcgaccgtcttgtgcgcgaaaacgggtgcgactggatcaaactggattttaatctcaac
cctggcgccggctgcaaccgcaccgatcatgggcatggcgcggaagacggattgtatgcc
cactatcgcggatactatgcgctcctcgaccggttgcgcgccacgcaccccgaggtcgta
ctggaaaattgctcgtcgggcgggctgcgcatcgatccgggcatcgcgcgccgcacgcac
atggcattcctgagcgacccggactggcccgaacacagtttgcaggtgttttggggcgca
acctgtatgctcgcaccggatgcctgcctgcactggggctacagtgagtgggcatttgcg
gaacatccgagccagacattcaatccgtgcgatccggcgcttcagccgcaccaggtcgat
tgctacacccgcatttcgatgctgcggcgctttggcttctcgcagcgtctgcctgatctg
ccggaatgggtcgcgcagcggtacgctgaacatattcagttctacaaaacggtcatgcgg
cgctttgtgcgcgaggcggatatgtaccgcctgaccgggcaaccacttggcgaggggcgt
ggcgaccgctgggccggatttcagtaccggatgccggacggcaacgagcatctgatcgcg
atctttcgcctgcccggcggagaaccatcgcgcgcgctgcgcttgaaacacctgcaaccg
gatcgcgtctataccctttcgtggatcgataccgggcatcgggcgcagatgaacggcgct
actttgatggatgccgggctgcatgtcgagaacctgccggaagaaggatcggccatcgtg
ctgatccacggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system