KEGG   Roseiflexus castenholzii DSM13941: Rcas_3563Help
Entry
Rcas_3563         CDS       T00585                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rca00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rca00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rca00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4651600..4653654
Genome map
AA seq 684 aa AA seqDB search
MTIPATLDHSTAGLVCLLRLIPHIGLMRLGLAHESWALDSSALFAAVIDGQLFDAQTPGA
QVRHVSESETPPGMRHVCVELAYADSGIVVAYHIVTYADSAALETWIVVQNEGDVPRRVT
RLDSLALDLPPDGYHLCAFTGAWGAEFEPQRMILNSAITLESRSGRSSHGHHPWFTLVRN
GRSLMSGMIAWSGNWVIRFTPKLDGALALSGGLHNWEFAVDLAPGASVAAPPVTLAFATG
ADLDETAVQFARLGRQFWYPRNALADALPVEWNHWWAYEDRALDEATFRANVDVAARLGI
EVCTLDAGWFGAPDADTHWYEQRGDWDRVNTARFPSGIRALADDVHAHGMRFGIWCEIEG
LGIHAQLAERHPEFIAMRDGERLGYVCLGNPAAQQWAFETLDRLVRENGCDWIKLDFNLN
PGAGCNRTDHGHGAEDGLYAHYRGYYALLDRLRATHPEVVLENCSSGGLRIDPGIARRTH
MAFLSDPDWPEHSLQVFWGATCMLAPDACLHWGYSEWAFAEHPSQTFNPCDPALQPHQVD
CYTRISMLRRFGFSQRLPDLPEWVAQRYAEHIQFYKTVMRRFVREADMYRLTGQPLGEGR
GDRWAGFQYRMPDGNEHLIAIFRLPGGEPSRALRLKHLQPDRVYTLSWIDTGHRAQMNGA
TLMDAGLHVENLPEEGSAIVLIHG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccccgccacgctcgatcactccactgctggacttgtctgcctgctgcgtctt
attccacacatcgggctgatgcgtctcgggctggcgcatgagtcgtgggcgttggattca
tcggcgctctttgcggcagtgattgatggacaattgttcgatgcacagacaccgggcgcc
caggtgcggcatgtgtcagagtctgaaacgccgcctggcatgcgccacgtgtgtgttgaa
ctggcatatgccgattccgggatcgtcgttgcgtatcatatcgtaacctatgccgatagt
gcggcgttggagacatggatcgtcgtgcagaatgagggagacgtaccgcgtcgcgtgacc
cgtctggactcgctggcgctcgatcttcctcccgatggataccatctctgcgcctttacc
ggcgcatggggcgcagagttcgagccgcagcgcatgatcctcaatagcgccatcaccctg
gaaagccggtctggacgctcatcgcacggccatcatccctggtttacgcttgtgcgcaat
ggtcgctcgctgatgtccggcatgattgcgtggtcgggcaactgggtgatccgtttcacg
ccaaagctggatggcgctctcgcgctgtcgggcgggttgcacaactgggaattcgccgtc
gatcttgcgccgggcgcatcggtcgcggcgccgccggtgacactggcgttcgcaacaggc
gccgatctcgatgagacggcggttcagtttgcgcgtttgggacggcagttctggtatccg
cgcaatgcgctggcggatgcgctgccggtcgagtggaaccactggtgggcatacgaagac
cgcgcactcgatgaggcgaccttccgcgccaatgtcgatgtcgcggcgcgcctgggcatc
gaggtatgcaccctcgacgccggatggttcggtgcgccggacgccgatacgcactggtac
gaacaacgcggcgactgggatagggtcaatactgcgcgcttcccgtccggcattcgcgca
cttgccgatgatgtccacgcgcatggcatgcgtttcggcatctggtgcgaaattgagggg
cttggcatccacgcgcaactggcagagcggcatcctgaattcatcgccatgcgcgacggt
gaacgccttgggtacgtctgccttggcaatccggcggcgcagcagtgggcattcgagacg
ctcgaccgtcttgtgcgcgaaaacgggtgcgactggatcaaactggattttaatctcaac
cctggcgccggctgcaaccgcaccgatcatgggcatggcgcggaagacggattgtatgcc
cactatcgcggatactatgcgctcctcgaccggttgcgcgccacgcaccccgaggtcgta
ctggaaaattgctcgtcgggcgggctgcgcatcgatccgggcatcgcgcgccgcacgcac
atggcattcctgagcgacccggactggcccgaacacagtttgcaggtgttttggggcgca
acctgtatgctcgcaccggatgcctgcctgcactggggctacagtgagtgggcatttgcg
gaacatccgagccagacattcaatccgtgcgatccggcgcttcagccgcaccaggtcgat
tgctacacccgcatttcgatgctgcggcgctttggcttctcgcagcgtctgcctgatctg
ccggaatgggtcgcgcagcggtacgctgaacatattcagttctacaaaacggtcatgcgg
cgctttgtgcgcgaggcggatatgtaccgcctgaccgggcaaccacttggcgaggggcgt
ggcgaccgctgggccggatttcagtaccggatgccggacggcaacgagcatctgatcgcg
atctttcgcctgcccggcggagaaccatcgcgcgcgctgcgcttgaaacacctgcaaccg
gatcgcgtctataccctttcgtggatcgataccgggcatcgggcgcagatgaacggcgct
actttgatggatgccgggctgcatgtcgagaacctgccggaagaaggatcggccatcgtg
ctgatccacggatga

DBGET integrated database retrieval system