KEGG   Roseiflexus castenholzii: Rcas_3652Help
Entry
Rcas_3652         CDS       T00585                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00521  Streptomycin biosynthesis
rca00523  Polyketide sugar unit biosynthesis
rca01130  Biosynthesis of antibiotics
Module
rca_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rcas_3652
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rcas_3652
Enzymes [BR:rca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rcas_3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABU59701
JGI: Rcas3652
UniProt: A7NQ55
Position
complement(4781793..4782374)
Genome map
AA seq 193 aa AA seqDB search
MQFTIHKTPLPGAVIIEPVCFRDERGFFLESWNSRDFAARGIAIDFVQDNHSRSVKNVLR
GFHYQDMTAPMVKLVRCTLGNVLDVIVDLRVGSPTFGRWHAVELTADNMLQLLVPIGFGH
AFLTLSDVAEIQYKCSIYYTPAAEGVIAWNDPDIGVPWPVTDPILSQRDRKGMRLAEYLE
RPAFRFGNVEGAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcaccattcacaaaacgccactgcccggcgccgtgatcatcgaaccggtctgt
ttccgcgatgagcgcggcttttttctggagtcgtggaactcccgcgatttcgcggcgcgc
ggcattgcaatcgatttcgtgcaggacaatcactcgcgctcggtgaagaacgtgttgcgc
ggcttccactaccaggatatgacggcgccaatggtgaaactggtgcgctgcacgctggga
aacgtccttgatgtgatcgtcgatttgcgcgtgggatcacccaccttcgggcgctggcat
gccgtggaattgacagcagacaacatgttgcaactgttggttccaattgggttcgggcat
gcgtttctcacgctctccgatgtggcggagattcagtacaaatgcagcatatactacacc
cccgccgccgaaggggtcatcgcctggaacgatcccgacattggcgtcccctggcccgtg
accgatccgatcctctcgcagcgcgaccggaaagggatgcggctggcagagtatcttgaa
cgtccggcgttccggttcgggaatgtggaaggtgcaggttga

DBGET integrated database retrieval system