KEGG   Roseiflexus castenholzii: Rcas_3765Help
Entry
Rcas_3765         CDS       T00585                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rca  Roseiflexus castenholzii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rcas_3765
Enzymes [BR:rca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rcas_3765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4937501..4938415
Genome map
AA seq 304 aa AA seqDB search
MTIVVFGSINMDLVVRTPRLPAPGETLTGHSFFTAPGGKGANQAVACARLDAPTRMVGRV
GDDLFGEQLRHSLRSFGVQDDGVLTTPGPSGVALIAVDDAAENTIVIVPGANGAVGSEDM
PRLERALDGARALLLQLETPLATVAAAARAGRARGATVILDPAPALPLPDELYALADILT
PNESEATTLTGIPVHDEQSAAAAARALRARGARTVIIKLGARGALAADANGVRFWPAFTV
TAVDTVAAGDAFNGGLAVALSEGRPFEEAIRWGLAAGALSVTKHGAQPSMPDRAELLALS
GVRG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattgttgtgtttggcagcatcaacatggacctggtggtgcgcacgccgcgtctg
ccggcgcccggcgaaacgctcaccggtcattcattctttacagcgccggggggcaaaggc
gccaatcaggccgtcgcctgcgcgcgactcgatgcaccgacccggatggttgggcgtgtc
ggcgatgatctgttcggtgaacaattgcgacacagcctgcggtcttttggtgtgcaggac
gatggcgtgctgacaacccccggtccgtcgggggtggcgctgatcgccgtcgatgacgcg
gcagagaacaccatcgtaatcgttccaggcgcgaatggcgccgtcggcagcgaggacatg
ccacggctggagcgggcgctcgatggcgcgcgcgcgctgctgttgcaactcgaaacgccg
cttgcgacggttgcggcggcggcgcgcgccgggcgcgcgcgcggcgcgacggtcattctc
gatccggcgccggcgctgccgctgcctgatgaattgtatgcgctggcggacattctaacg
ccgaacgaaagtgaagcgacaaccctgaccggcatccccgtccatgatgagcagagtgcg
gcggcggcggcgcgggcattgcgtgcgcgcggcgcgcgaacggtcattatcaaactcggc
gcgcgcggcgcacttgcggcagacgcgaacggcgtgcgcttctggcccgccttcaccgtc
acggcggtcgataccgtcgctgcgggagacgccttcaacggcgggctggcggtggcgctg
agcgagggacgtcccttcgaggaagccatccggtggggactggctgcgggcgcgctgtcc
gtcaccaaacatggtgcgcagccgtcgatgccggatcgggcggaactgctggcgttgtca
ggggtgaggggctag

DBGET integrated database retrieval system