KEGG   Roseiflexus castenholzii DSM13941: Rcas_3836Help
Entry
Rcas_3836         CDS       T00585                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rca03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5014807..5015658
Genome map
AA seq 283 aa AA seqDB search
MPELPEVQHTADSLGIQIAGARIARVERLDWTRMVETPSPDEFIRLLTGRQVRGWDRRAK
WILLFLDDGWTLALHLRMSGSLTVHPAEAQPDKHTHLALRLEDGRQIFFLDPRKFGRARL
LDSAGLAALDAAHGDEPLSDAFTVERLASLLRNRKRAIKPLLLDQSVIAGIGNIYADEAL
WRARIHPLRPAADLSAAEVAALHDGIRAALRQALANGGSTLRDYRNSYGAGGTNQEHFNA
YDREGRPCPRCGATIIKTVVAQRGTHYCPACQAIPSATTNRRE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttgcctgaagttcaacacaccgccgatagtctggggatacagatcgccggt
gcacggattgcgcgcgtcgaacggctcgactggacccgcatggtggaaaccccatcgccc
gatgagttcatcagactgctcaccggtcggcaggtgcgcggatgggaccgacgcgccaag
tggattctgctctttctcgatgacggttggacgctggcgctgcatctgcgcatgtccggc
agtctgacggttcatcccgccgaggcacaaccggacaaacacacgcatctggcgctgcgc
ctcgaagatggacgccagatattcttcctcgacccgcgcaagtttgggcgcgcgcggctg
ctcgactccgccggtctcgcggcgctcgacgcggcgcacggcgatgagccgctgtcggac
gcattcacggtcgagcgtctggcatccctgctacgtaaccgcaaacgcgcaatcaagccg
ctccttctcgatcaatcagtgatcgccgggatcggaaacatctacgccgacgaggcgctc
tggcgcgcccgcatccacccgctgcgccccgcagccgacctgagcgccgctgaagttgcc
gcactccacgatggcattcgcgcggcgctacggcaggcgctcgccaacggcggcagcacc
ctgcgcgactaccgcaactcctatggcgcgggtggcacgaatcaggagcatttcaacgcc
tacgaccgcgagggacgaccatgcccgcgttgcggcgccacgattatcaagaccgtggtt
gcgcaacggggaacgcactactgcccggcgtgccaggctattccgtcagcaacgaccaac
cgccgcgaatga

DBGET integrated database retrieval system