KEGG   Roseiflexus castenholzii: Rcas_3934Help
Entry
Rcas_3934         CDS       T00585                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_3934
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_3934
   00620 Pyruvate metabolism
    Rcas_3934
   00640 Propanoate metabolism
    Rcas_3934
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Rcas_3934
   00680 Methane metabolism
    Rcas_3934
Enzymes [BR:rca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rcas_3934
Lipid biosynthesis proteins [BR:rca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rcas_3934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5132793..5134712
Genome map
AA seq 639 aa AA seqDB search
MTLTYAIGSTNNVEATDVVVGPLEDAARNANLTDYESVYRRSIEDPQGFWAEAAQALHWF
EPFHTVLDESNAPFYKWFVGGKTNMAYNALDRHVQTWRKNKVALIWESEDGIVRTYTYWQ
LYRDVNKFANVLKSLGVRKGDRVAIYTGRCPEQAIAMLACARIGAVHTVVYGGLSTEALR
SRIEDAHAKVLVVADGSLLNGKIVKLKEIADQAVDHAPSIETCVVIKRTGHDVDIRNGRD
YWWHELMSLPIASARCESEPLDAEDPFFIIYTSGSTGKPKGVVHTLGGYMVDVYTTLKYV
LDFKEEDTLFCTSDAGWIVGHSIVLYGPLMHGITTLMYEGAPAYPYPDRWWHLIERHGVT
LMFTAPTGVRGLMRYGDAWPKRRDLSTLRLLACAGEPLNPEAWRWFYEVIGQRRCPVIDN
WWQTETSRPMISNFASLPMKPGSCAFPVPGVALDIVDEQGQSVPPGVEGALVITRPWPSM
LRTIYGDDQRYIDQYWSRYPGKYLTGDAAKRDADGYMWIIGRTDDVIKVSGYRLGTAEVE
SALVSHPAVAEAAVIGLPHPVRGNAIHAFVLLRAGYSPSEELANELKAHVGKVMGPIAKP
ETISFPPTLPKTRSGKIMRRVLRAQALGEPLGDLSTMEG
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgacactcacctacgcgattggttcgaccaacaacgtcgaagccaccgacgttgttgtg
ggtccactggaggatgctgcgcgcaatgcgaacctgaccgattacgagtcggtctatcgt
cggtcgattgaggatccgcaggggttttgggcagaggcggcacaggcgctgcactggttc
gagccgttccacaccgtgctcgatgaaagcaatgcgcccttctacaaatggttcgtcggc
ggcaagacgaatatggcgtacaacgctcttgatcgccacgtgcagacctggcgcaaaaac
aaggtggcgctgatctgggagagtgaagacggcattgttcgcacctacacctactggcaa
ttgtaccgcgacgtcaataagtttgccaatgtgctcaaatcgcttggcgtgcgcaaaggc
gaccgggtggcgatctacacgggacgctgtccggagcaggcaattgcaatgctggcatgc
gcccgcattggcgccgtgcatacggtcgtctacggcggtctttcgaccgaggcgctgcgc
agtcgcatcgaagatgcgcatgccaaagtgctggtggtggcggatggcagtctgctgaac
ggcaagatcgtcaaactgaaggaaatcgcggatcaggcggtcgatcatgcgccgtcgatt
gaaacgtgtgtggtcatcaaacgcaccgggcacgacgttgatattcggaatgggcgcgac
tactggtggcacgagttgatgagcctgcctatcgcctcggcgcgttgcgagagtgagccg
ctcgacgcagaagaccccttcttcatcatctatacgtcaggctccaccggcaaacccaag
ggtgtggtgcatacgctcggcgggtatatggtggatgtgtatacaacgctgaagtacgtg
ctcgatttcaaggaagaagatacgctcttctgcacctccgacgcaggatggatcgtcggg
cactcgattgtgctgtatggtccgttgatgcacggcattaccacgctgatgtacgaaggc
gcgcccgcctacccctacccggatcgctggtggcacctgatcgagcggcatggcgtgacg
ctgatgttcacggcgccaaccggtgtgcgtgggttgatgcggtatggcgacgcctggccc
aaacgacgcgatctgagcaccctgcgtctgctggcgtgcgcgggtgagccgctgaaccct
gaagcctggcgctggttctacgaggtgatcgggcagcgccgctgtccggtgatcgataac
tggtggcagaccgaaacctcgcgcccgatgatttcgaactttgcttcgctgccgatgaaa
cccggttcctgcgcattcccggttccgggagtcgcactcgacattgttgatgagcagggg
cagagcgtgccgcccggcgtcgaaggcgcactggtcatcactcgcccatggccctcgatg
ttgcgcaccatctatggcgacgatcagcgctacatcgatcagtactggagccgctatccg
gggaagtacctcaccggcgacgccgccaagcgcgatgctgatgggtatatgtggatcatt
ggtcgcaccgacgatgtcatcaaagtctccggctatcgcctgggcactgcggaggtcgaa
agcgccctcgtgtcgcatccggcagtggcggaagccgcagtcatcggtttgccgcatccg
gtgcgcgggaatgcgattcatgccttcgttctgctccgcgccggatattcgccctcggaa
gaactggcgaatgaattgaaagcgcacgtcggcaaggtgatgggacctatcgccaagccg
gagacgatttcgttcccgccgactctaccgaagacccgttcgggcaagattatgcgccgt
gtgctgcgcgctcaggcgctcggcgagccgctcggcgacctcagtacgatggaggggtga

DBGET integrated database retrieval system