KEGG   Roseiflexus castenholzii: Rcas_4375Help
Entry
Rcas_4375         CDS       T00585                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00630  Glyoxylate and dicarboxylate metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01200  Carbon metabolism
Module
rca_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rcas_4375
Enzymes [BR:rca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rcas_4375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABU60399
JGI: Rcas4375
UniProt: A7NS53
Position
complement(5628515..5629801)
Genome map
AA seq 428 aa AA seqDB search
MAGLHRDRDIAELEQRWATDPRWQGIRRDYSAADVVRLRGTLKVEYTLASVGARRLWDLL
QNEPYVATFGALTGAQATQMVRAGLKAIYMSGWQVAADANLAGQTYPDQSLYPSNSVPAL
VRRINNALMRADQIHASEGKNDIYWYAPIVADAEAGFGGPLHAFELTKAMIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTSQFVRTLTAARLAADVLDVPTVLIARTDAQAATLLLSDA
DEYDRPFITGERTPEGFYRVKSGLDAAIARGLAYAPYADLIWCETAHPDLDEARRFAEGI
HAKFPGKMLAYNCSPSFNWKRNLDDATIAAFQRELAAMGYKFQFITLAGWHMINYHAFEL
AKAYAAEGMTAYVKLQQAEFAAEQEGYTATRHQREVGTGYFDEVSTIISGGLSSTTALAG
STEEEQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctggtttacatcgcgaccgggacatcgccgaactggagcagcgctgggcgaccgat
ccgcgctggcagggcatccgccgtgactacagcgccgccgatgtggtgcgtttgcgcggg
acgctgaaagtcgagtacaccctggcaagcgtgggggcgcgacgcctgtgggacctgttg
cagaacgagccgtatgttgccacatttggggcgctgaccggtgcacaggcgacgcaaatg
gttcgcgccggtcttaaggcgatctatatgagtggctggcaggtcgctgccgatgcgaat
ctggcggggcagacctatcccgatcagagtctctatccgtcgaacagcgtcccggcgctg
gtgcggcggatcaataatgcgctcatgcgtgccgatcagattcacgcatcggaaggtaag
aacgatatctactggtatgccccaatcgttgccgatgccgaggcgggctttggcggtccg
ctccatgcctttgaattgacgaaggcgatgatcgaggccggcgcagccggcgtccatttc
gaggatcagttggcatcggaaaagaagtgtggtcatctgggcggtaaggtgctcgtgcca
acgtcgcagttcgtccgcacgctgacggcggcgcgcctggcagccgatgtgctcgatgtg
ccaacggtgttgattgcgcgcaccgatgcgcaggcggcgacgctcctcctctccgatgcc
gatgaatacgatcgccccttcattaccggtgagcgcacgccggaaggtttctatcgcgtg
aagagcggcctggatgcggcgattgcccgtggtctggcgtatgcgccgtatgccgatctg
atctggtgcgagacggcgcaccccgatctggacgaggcgcgccggttcgccgaaggcatc
cacgcgaagttccccggtaagatgctggcgtacaactgctcgccatccttcaactggaag
cgcaacctggacgacgcaacgatcgcagcgttccagcgcgaactggcggcaatgggctat
aagttccagttcattacgctggcgggctggcatatgatcaactaccacgccttcgaactc
gccaaagcctatgctgctgaagggatgaccgcgtatgtgaagttgcagcaggcggaattc
gccgccgagcaggaaggatataccgcaacccgacatcagcgcgaggtggggaccggctat
ttcgatgaggtgtccacgattatctctggcggtctgtcttcgacgactgcactcgccggt
tcgaccgaagaggagcagttccattga

DBGET integrated database retrieval system