KEGG   Roseiflexus castenholzii: Rcas_4375Help
Entry
Rcas_4375         CDS       T00585                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rca  Roseiflexus castenholzii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_4375
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rcas_4375
Enzymes [BR:rca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rcas_4375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5628515..5629801)
Genome map
AA seq 428 aa AA seqDB search
MAGLHRDRDIAELEQRWATDPRWQGIRRDYSAADVVRLRGTLKVEYTLASVGARRLWDLL
QNEPYVATFGALTGAQATQMVRAGLKAIYMSGWQVAADANLAGQTYPDQSLYPSNSVPAL
VRRINNALMRADQIHASEGKNDIYWYAPIVADAEAGFGGPLHAFELTKAMIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTSQFVRTLTAARLAADVLDVPTVLIARTDAQAATLLLSDA
DEYDRPFITGERTPEGFYRVKSGLDAAIARGLAYAPYADLIWCETAHPDLDEARRFAEGI
HAKFPGKMLAYNCSPSFNWKRNLDDATIAAFQRELAAMGYKFQFITLAGWHMINYHAFEL
AKAYAAEGMTAYVKLQQAEFAAEQEGYTATRHQREVGTGYFDEVSTIISGGLSSTTALAG
STEEEQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctggtttacatcgcgaccgggacatcgccgaactggagcagcgctgggcgaccgat
ccgcgctggcagggcatccgccgtgactacagcgccgccgatgtggtgcgtttgcgcggg
acgctgaaagtcgagtacaccctggcaagcgtgggggcgcgacgcctgtgggacctgttg
cagaacgagccgtatgttgccacatttggggcgctgaccggtgcacaggcgacgcaaatg
gttcgcgccggtcttaaggcgatctatatgagtggctggcaggtcgctgccgatgcgaat
ctggcggggcagacctatcccgatcagagtctctatccgtcgaacagcgtcccggcgctg
gtgcggcggatcaataatgcgctcatgcgtgccgatcagattcacgcatcggaaggtaag
aacgatatctactggtatgccccaatcgttgccgatgccgaggcgggctttggcggtccg
ctccatgcctttgaattgacgaaggcgatgatcgaggccggcgcagccggcgtccatttc
gaggatcagttggcatcggaaaagaagtgtggtcatctgggcggtaaggtgctcgtgcca
acgtcgcagttcgtccgcacgctgacggcggcgcgcctggcagccgatgtgctcgatgtg
ccaacggtgttgattgcgcgcaccgatgcgcaggcggcgacgctcctcctctccgatgcc
gatgaatacgatcgccccttcattaccggtgagcgcacgccggaaggtttctatcgcgtg
aagagcggcctggatgcggcgattgcccgtggtctggcgtatgcgccgtatgccgatctg
atctggtgcgagacggcgcaccccgatctggacgaggcgcgccggttcgccgaaggcatc
cacgcgaagttccccggtaagatgctggcgtacaactgctcgccatccttcaactggaag
cgcaacctggacgacgcaacgatcgcagcgttccagcgcgaactggcggcaatgggctat
aagttccagttcattacgctggcgggctggcatatgatcaactaccacgccttcgaactc
gccaaagcctatgctgctgaagggatgaccgcgtatgtgaagttgcagcaggcggaattc
gccgccgagcaggaaggatataccgcaacccgacatcagcgcgaggtggggaccggctat
ttcgatgaggtgtccacgattatctctggcggtctgtcttcgacgactgcactcgccggt
tcgaccgaagaggagcagttccattga

DBGET integrated database retrieval system