KEGG   Roseiflexus castenholzii: Rcas_4376Help
Entry
Rcas_4376         CDS       T00585                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rca  Roseiflexus castenholzii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rcas_4376
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rcas_4376
   00630 Glyoxylate and dicarboxylate metabolism
    Rcas_4376
Enzymes [BR:rca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rcas_4376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5629822..5631393)
Genome map
AA seq 523 aa AA seqDB search
MDTPQRVEILGSTRPEWSEILSVEALDFIAALARQFEHRRRALLAAREQRWADIRGGALP
DFLSETAEIRGSDWKVASIPADFSNRRVEITGPTDRRMVINALNSGAQVFMADFEDANAP
TWENMVQGQLNLRDAVRRTITFVSPEGREYRLNDTIATLAVRPRGWHLIEKHVHVDGEPV
AGAFFDFGLYFFHNARELIRRGSGPYFYLPKMQSHLEARLWNDVFNFAQDRLGIPRGTIR
ATVLIEHILAVFEMEEILYELREHSSGLNLGRWDYIYSFIKTFNHRSDWIFPDRAQVTMT
THFLRSAAELLVYSCHRRGAHALGGMSAFIPNRREPEITERALAQVRADKEREAKQGFDG
AWVAHPDLVPTVLEVFSAAYEGDHQIHYVPQVHVTAADLLTIPQGTITEAGLRNNITVAL
QYIEAWLGGRGAVAIFNLMEDVATAEIARSQLWQWVRYNARLDDGRTIDETMYKTMRDEE
LHTLVAARTGDHHFALAAELLDELTLSRDFVEFLTIPGYRRLD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtggacacaccgcagcgtgtcgaaattctcggttcgaccaggccggagtggtcggagatc
ctctcggttgaagcgctcgattttattgctgctctggcgcgtcagttcgaacatcgccgg
cgcgcgttgcttgcggcgcgcgagcagcgttgggcggatatcagagggggcgcattgccc
gattttctgtcggagacggctgagattcgcggcagtgattggaaggtggcgtcgatccct
gccgatttctcgaaccggcgtgtggagattaccggtccgaccgatcggcgtatggtgatt
aacgccctgaactccggtgcgcaggtgttcatggccgattttgaggacgcgaatgcgccc
acctgggagaatatggtgcaggggcagctcaacctgcgcgatgccgtgcgtcggacgatc
acgttcgtcagtccggaggggcgcgagtatcgcctgaacgacacgattgcaacgctggcg
gtgcgtccgcgtggctggcatctgattgagaagcatgtccatgtggacggcgagccggtg
gccggcgcgttcttcgatttcggtctttatttcttccacaatgcgcgcgaattgatccga
cgcggcagcggtccgtacttctatctgccgaagatgcagagccatctggaagcgcgcctg
tggaacgatgtgttcaattttgcccaggatcggcttggtattccgcgcggcacgatccgt
gcaacggtgctgatcgagcatattcttgccgtcttcgaaatggaagaaatcctttacgaa
ttgcgtgagcatagcagcggcttgaacctgggacgctgggattatatctacagttttatt
aagacgttcaaccatcgcagcgactggatttttcccgatcgggcgcaggtgacgatgacg
acacatttcctgcgctcagcggcggaactcctggtctattcctgccacaggcgcggcgct
cacgcgctcggtggtatgtcggcgtttattccgaaccggcgtgagccggagattactgaa
cgcgcgctggcgcaggttcgcgccgataaggagcgtgaggcaaagcaggggttcgatggc
gcctgggtggcgcatcccgacctggtgccaactgtgcttgaggtcttcagtgccgcgtat
gagggcgatcatcagatccattacgtgccgcaggttcatgtcactgctgccgatctgctg
accattccgcaggggacgattaccgaagcggggttgcgcaacaatatcacggttgcgttg
cagtacatcgaagcgtggttgggcggtcgcggcgcggtggcgatcttcaacttgatggaa
gatgtggcgacggcggaaattgcgcgctcgcaactctggcagtgggtgcgctacaatgcc
cgcctggatgatggacgcaccattgatgagacaatgtataagacgatgcgcgacgaagaa
ttgcacacgctggtcgcggcgcgcaccggtgatcatcattttgcgctggcggcggaattg
ctcgatgaactgacgctgtcgcgcgattttgtggagttcctgaccatccccggctatcgc
cgtctggattga

DBGET integrated database retrieval system