KEGG   Roseiflexus castenholzii: Rcas_4434Help
Entry
Rcas_4434         CDS       T00585                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00010  Glycolysis / Gluconeogenesis
rca00071  Fatty acid degradation
rca00350  Tyrosine metabolism
rca00625  Chloroalkane and chloroalkene degradation
rca00626  Naphthalene degradation
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_4434
  Lipid metabolism
   00071 Fatty acid degradation
    Rcas_4434
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rcas_4434
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rcas_4434
   00626 Naphthalene degradation
    Rcas_4434
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rcas_4434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABU60450
JGI: Rcas4434
UniProt: A7NSA4
Position
complement(5702579..5703604)
Genome map
AA seq 341 aa AA seqDB search
MTTMKAAVVHDFQQPLRIEELPKPEPGFGEIVVKIEASGLCHTDIHAAHGDWPVKPKLPF
IPGHEGVGIVESVGPGVTNVKEGDRVAIPWLGYACGDCKYCASGWETLCERQLNTGYFLD
GAYAQYAKAFAKYVGIVPQGVSPLDAAPLTCAGVTTYKAVKVSGARPSELVAVFGVGGLG
HLALQYAKIAGATVAAIDLLDERLQTARELGADITINAKTQDPVEELKKWGGADAAICVA
VSPKAFEQAYHSLSRGGRLVFVALPADNYIQLPIFETVLKGIHVIGSIVGTRADLAETFA
LHAAGKTRVLYETRALDQVNEAFDDVEHGRNKAPRIVFSEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgaaggccgctgttgtccacgacttccagcaaccgttgcgcatcgaggaa
ttgcccaagccggagccgggattcggtgagattgtggtcaaaatcgaagcgtctggtttg
tgccacaccgacattcacgctgcgcatggcgactggccggtgaaaccaaaactgccattt
atccctggtcatgaaggcgtaggcattgtcgaaagcgtcggaccaggcgtgacaaatgtg
aaggaaggtgaccgcgtcgcgatcccctggctgggatatgcgtgcggcgattgtaaatac
tgtgcgtctggttgggagacgctctgcgaacgtcaactcaacaccggctactttcttgat
ggtgcgtatgctcagtatgccaaagccttcgcaaaatacgtgggcatcgttcctcagggc
gtgtcgccgctcgatgctgcgccgctcacttgtgccggcgtcacgacctacaaggcggtc
aaagtctccggggcgcgcccttcggagttggtcgccgtttttggcgtcgggggattggga
catctggcgttgcagtacgcgaagatcgccggagcgacggtcgcagcgatcgacctgctc
gatgagcggttgcagactgcgcgggaactcggcgccgatattacgatcaacgccaaaacc
caggatccggtggaagaactgaagaaatggggcggcgccgacgccgcgatctgcgtagca
gtctcaccgaaggcgtttgagcaggcgtatcattcattgagtcggggcggacgactggtg
tttgttgcccttcccgccgacaattacattcagttgcccatttttgagaccgtgctcaaa
ggcattcacgtgattggctcgattgtcggcacccgtgccgacctggcggagacgtttgcg
ctccatgctgccgggaagacgcgcgtgctctatgagacccgcgcgctcgatcaggtgaac
gaagcgttcgacgatgtcgagcatggacggaataaggcgccacgtatcgttttctctgaa
ttgtaa

DBGET integrated database retrieval system