KEGG   Roseiflexus castenholzii DSM13941: Rcas_4446Help
Entry
Rcas_4446         CDS       T00585                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rca01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rca00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5713675..5714856
Genome map
AA seq 393 aa AA seqDB search
MQRLSAHTRACALSPLARASCLIPERMAYPNRIVVKVGTNVLTAGADKVHRPTIVALAQQ
IAAVRSQGVEIVLVSSGAIAVGRERLNFPARRRDIPLKQMLAAVGQSRLMHLYEQIFELY
GITVAQTLLTRGDLADRNRYLNARNTLLACLMHNVLPIVNENDVVAVSEIRVGDNDNLSA
LVTNLVDADLLLILTDIDGLYTADPRRDPSATRIDLVPEITEHIYAIAGGSNIRGTGGML
TKIQAADLATRSGAEVVIARGAERDVIARVVAGEAIGTRFPAQATNVESRKRWILAETVR
HSRVVVDEGAARALMTGGKSLLPAGVVAVEGDFARGQTVRIYATDGREIARGITQYAAVD
LRRIRGLQSSQIAETLGFDYGPEAVHRDDMVLL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggctctctgcccacacccgcgcctgcgcgctctcgcctcttgcccgcgcctct
tgcctcatacctgaacgtatggcctatcccaaccgcattgttgtcaaagtcggcaccaat
gttctcaccgccggcgccgataaggtgcatcgcccgacaatcgtggcgctggcgcagcag
attgctgcggtgcgcagtcagggggttgagatcgtgctggtgagttccggcgctatcgct
gtggggcgtgaacgcttgaactttccggcgcgacggcgtgatattccgctcaaacagatg
ctcgcggcggttggacagagccggttgatgcatctgtatgagcaaatcttcgaactctat
ggcattaccgtggcgcagacgcttctgacccgcggcgatctggcggaccggaatcggtac
ctgaatgcgcgcaatacgctgctcgcctgcctgatgcacaatgttttgccaatcgtcaac
gaaaacgatgtggtcgcggtcagtgagattcgcgtcggagacaacgataatctttcagcg
ctggtcacgaacctggtcgatgccgatctgctcctgatcctgaccgacattgacggtctc
tacaccgccgatccgcgccgcgatccatctgcaacgcggatcgacctggtacccgaaatt
actgaacatatctatgcgatcgcaggcggaagcaatatacgtggcacgggtggcatgcta
accaaaattcaggcggcagacctggcgacgcgcagtggcgctgaggtggtgatcgcgcgt
ggcgctgaacgcgatgttattgcgcgcgtcgtggcaggtgaggcgatcggtacccgcttt
ccagcgcaggcgacaaacgtcgagagccgaaaacgctggattcttgcggaaaccgtccgt
catagccgtgttgtcgtcgatgaaggcgcggcacgtgccttgatgacaggcggcaagagt
ctcttgccggccggcgtggtcgccgttgaaggcgattttgcccgtgggcaaactgttcgc
atttatgcaaccgatggcagggagattgcacgcggtatcacacagtacgcggcggttgac
cttcgccgcattcgcgggttgcaatcgtcgcagattgccgaaacgctcggcttcgactat
ggtcccgaagcggtgcaccgcgatgatatggtgctgttgtaa

DBGET integrated database retrieval system