KEGG   Roseiflexus castenholzii: Rcas_4446Help
Entry
Rcas_4446         CDS       T00585                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rca  Roseiflexus castenholzii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rcas_4446
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rcas_4446
Enzymes [BR:rca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rcas_4446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5713675..5714856
Genome map
AA seq 393 aa AA seqDB search
MQRLSAHTRACALSPLARASCLIPERMAYPNRIVVKVGTNVLTAGADKVHRPTIVALAQQ
IAAVRSQGVEIVLVSSGAIAVGRERLNFPARRRDIPLKQMLAAVGQSRLMHLYEQIFELY
GITVAQTLLTRGDLADRNRYLNARNTLLACLMHNVLPIVNENDVVAVSEIRVGDNDNLSA
LVTNLVDADLLLILTDIDGLYTADPRRDPSATRIDLVPEITEHIYAIAGGSNIRGTGGML
TKIQAADLATRSGAEVVIARGAERDVIARVVAGEAIGTRFPAQATNVESRKRWILAETVR
HSRVVVDEGAARALMTGGKSLLPAGVVAVEGDFARGQTVRIYATDGREIARGITQYAAVD
LRRIRGLQSSQIAETLGFDYGPEAVHRDDMVLL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggctctctgcccacacccgcgcctgcgcgctctcgcctcttgcccgcgcctct
tgcctcatacctgaacgtatggcctatcccaaccgcattgttgtcaaagtcggcaccaat
gttctcaccgccggcgccgataaggtgcatcgcccgacaatcgtggcgctggcgcagcag
attgctgcggtgcgcagtcagggggttgagatcgtgctggtgagttccggcgctatcgct
gtggggcgtgaacgcttgaactttccggcgcgacggcgtgatattccgctcaaacagatg
ctcgcggcggttggacagagccggttgatgcatctgtatgagcaaatcttcgaactctat
ggcattaccgtggcgcagacgcttctgacccgcggcgatctggcggaccggaatcggtac
ctgaatgcgcgcaatacgctgctcgcctgcctgatgcacaatgttttgccaatcgtcaac
gaaaacgatgtggtcgcggtcagtgagattcgcgtcggagacaacgataatctttcagcg
ctggtcacgaacctggtcgatgccgatctgctcctgatcctgaccgacattgacggtctc
tacaccgccgatccgcgccgcgatccatctgcaacgcggatcgacctggtacccgaaatt
actgaacatatctatgcgatcgcaggcggaagcaatatacgtggcacgggtggcatgcta
accaaaattcaggcggcagacctggcgacgcgcagtggcgctgaggtggtgatcgcgcgt
ggcgctgaacgcgatgttattgcgcgcgtcgtggcaggtgaggcgatcggtacccgcttt
ccagcgcaggcgacaaacgtcgagagccgaaaacgctggattcttgcggaaaccgtccgt
catagccgtgttgtcgtcgatgaaggcgcggcacgtgccttgatgacaggcggcaagagt
ctcttgccggccggcgtggtcgccgttgaaggcgattttgcccgtgggcaaactgttcgc
atttatgcaaccgatggcagggagattgcacgcggtatcacacagtacgcggcggttgac
cttcgccgcattcgcgggttgcaatcgtcgcagattgccgaaacgctcggcttcgactat
ggtcccgaagcggtgcaccgcgatgatatggtgctgttgtaa

DBGET integrated database retrieval system