KEGG   Rickettsia canadensis CA410: RCA_00940Help
Entry
RCA_00940         CDS       T01736                                 

Definition
coproporphyrinogen III oxidase
Orthology
K02495  
oxygen-independent coproporphyrinogen III oxidase [EC:1.3.99.22]
Organism
rcc  Rickettsia canadensis CA410
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCA_00940
Enzymes [BR:rcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.22  coproporphyrinogen dehydrogenase
     RCA_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(219819..220979)
Genome map
AA seq 386 aa AA seqDB search
MKVTTDDLSIYIHWPFCLSKCPYCDFNSHVASTIDHEQWLKSYEREIEYFKPIIQNKYIK
SIFFGGGTPSLMDPVIVEVIINKIINIAIIDHQTEITLETNPTSFETEKFKAFKSAGINR
VSIGVQSLKEDDLKKLGRTHDCMQAIKTIETANTIFPRVSFDLIYARSGQKLKDWQEELK
QAMQLATSHISLYQLTIEKGTLFYKLFRDGTLILPHSDEAAEMYEWTNHYLESKKYFRYE
ISNYALVSQECLHNLTYWNYNSYLGIGPGAHSRIIEPSSSVLAIMMWHKPEKWLDSVKIK
NVGIQTNIKLTHQEVIAEMLMMGLRLKSGINLSILEQKLNTKLENILDMNNLKHYQNQDL
IKLDQNVYLTDKGLMLHSYIVPRLIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacgacagatgatttaagtatttatattcattggccgttttgtttgtcaaaa
tgcccgtattgtgattttaattctcatgtggcaagcactatagatcatgaacagtggctt
aagtcctatgaaagggaaattgagtattttaagcccattattcaaaataaatatataaaa
tctattttttttggtggtggcactccttcattaatggatcctgtaatagtggaagtaata
ataaataaaatcattaatatagcgattattgatcatcaaaccgagataactctagaaaca
aatcctacatcctttgaaactgagaagtttaaagcattcaagtctgccggaattaatcgt
gtttcaattggagtacaatccttaaaagaagacgatttaaaaaaactaggtagaacccat
gattgtatgcaagcaattaaaacaattgagacggcaaatacgatttttccacgagtatca
tttgatttaatatatgcacgtagtggtcagaaattaaaagactggcaagaagaattaaaa
caagcaatgcagcttgctacctcgcatatttctctttatcagcttactattgaaaaaggt
acactgttttataaattatttagggacggtaccctgattttgccgcattcggatgaagca
gctgaaatgtatgaatggacaaaccattatctagaatctaaaaaatattttagatatgag
atatctaattatgctctagtaagtcaggaatgtttgcataatttaacttactggaattat
aatagttatttaggtataggtcctggagctcatagtagaatcattgaaccctcaagttca
gtattggcaattatgatgtggcataaacctgaaaaatggttagactcggttaaaataaaa
aatgttggtattcaaactaacattaagttaacacatcaagaagtcattgcagaaatgtta
atgatgggattacgtcttaaaagtggcataaatctttctatattagagcagaaattgaac
acaaaattagagaatattttagacatgaataatcttaaacattatcaaaaccaagaccta
attaagttagatcaaaatgtctatcttaccgataaaggtttgatgctgcatagttacata
gtacctagattgatcaagtaa

DBGET integrated database retrieval system