KEGG   Rickettsia canadensis CA410: RCA_01380Help
Entry
RCA_01380         CDS       T01736                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rcc  Rickettsia canadensis CA410
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RCA_01380
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RCA_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324679..325200)
Genome map
AA seq 173 aa AA seqDB search
MSGKELNKIVAAILLASLIAMMVGFVANILYKPNLQVLHRGYSVAVHENSVASTSEAPAA
VNIAELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSSAL
SKLDGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKLQEIADIILFLKTYVHDT
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttacttgctagtttaattgct
atgatggttgggtttgttgcaaatatattatacaaaccaaacttacaagttttacatcgt
ggttatagtgttgcagttcatgaaaattcagtagcctctacatcggaagcaccagcagca
gtaaatatagcagaattgatgaaaaccgctaatgccgataacggtcgtgaaatagccaaa
aaatgtttaatgtgtcattctcttgataaagatggtccaaataaactaggaccacatctt
tgggacgtagcaggtcgccctaaagcaagcatagcagactataaatattcctctgctcta
tcaaaacttgacggcgtatgggatgatgacagtttatttgctttcttacataaaccaagt
agctatgccccaggaactaaaatgtcctttgctggtatctcaaaactgcaagaaatagct
gatataatattatttttaaaaacttatgttcatgatacataa

DBGET integrated database retrieval system