KEGG   Rickettsia canadensis CA410: RCA_02160Help
Entry
RCA_02160         CDS       T01736                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rcc  Rickettsia canadensis CA410
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCA_02160
Enzymes [BR:rcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RCA_02160
Exosome [BR:rcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCA_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501457..502449
Genome map
AA seq 330 aa AA seqDB search
MYPLVRLRRNRKAFWLRELIAESNLSINDLVLPLFVVDGHNERQEIKTMPGIYRLPINQI
VETAKRAAELGINAIALFPSIDQSLKSENANEAYNLDNLICRTIRSIKNANVDIGIICDV
ALDPYTTHGHDGIVYHGEVDNDKSVRALGNQALVLAKAGVDIVAPSDMMDGRIGAIRKYL
DKEGFINVGILAYAAKYASSFYGPFRDAIRSNKRNYLDKSSYQMDVRNIKEAMLEIEHDI
SEGADMVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAEAGAIDWESTIIES
LTSFKRAGATAILTYAALEVAEILKNNKIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctcttgttagacttagaagaaatagaaaagcattttggcttagagagttaata
gctgaaagtaatttatcgatcaatgatttagtgctacctttatttgttgttgatgggcat
aatgaaagacaagaaattaagactatgcctggtatatatcgtttaccgatcaatcaaata
gtagagaccgctaaaagagcagcagagcttggtattaatgctattgcattatttcctagt
attgatcaaagtctaaaaagtgaaaatgccaacgaggcttataatttagataatttgata
tgtagaactattagaagcatcaaaaacgctaatgttgatatcggtataatatgcgatgta
gcactagatccttatactacacatggtcatgacggtattgtgtatcacggggaagttgat
aatgataaatcagtcagagccttaggtaatcaagcactagtgcttgcaaaagcaggggta
gatattgttgcaccttccgatatgatggatggcagaatcggagctataaggaaatacctt
gacaaagaggggtttataaatgtcggaattcttgcttatgcagctaaatatgcttcaagt
ttttatggtccgtttcgcgatgcaattaggagtaacaaaaggaattatttagataaatca
agctatcaaatggatgtacgtaatattaaggaagcaatgcttgaaattgaacacgatata
tctgaaggagctgatatggtaatggttaaaccaggtatgccgtttttagatgttattcgt
gaagcagcaaataattttaatgctaaaatttttgcatatcaggttagcggagaatatgca
atgttaaaatttgcagctgaagcaggggcaattgactgggagagcaccataattgaatca
ttaactagttttaaacgtgcaggagcaactgcgatattgacctacgcagctcttgaagta
gctgaaatattaaagaacaataaaattaagtag

DBGET integrated database retrieval system