KEGG   Rickettsia canadensis CA410: RCA_02515Help
Entry
RCA_02515         CDS       T01736                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rcc  Rickettsia canadensis CA410
Pathway
rcc00010  Glycolysis / Gluconeogenesis
rcc00020  Citrate cycle (TCA cycle)
rcc00620  Pyruvate metabolism
rcc01100  Metabolic pathways
rcc01110  Biosynthesis of secondary metabolites
rcc01120  Microbial metabolism in diverse environments
rcc01130  Biosynthesis of antibiotics
rcc01200  Carbon metabolism
Module
rcc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCA_02515
   00020 Citrate cycle (TCA cycle)
    RCA_02515
   00620 Pyruvate metabolism
    RCA_02515
Enzymes [BR:rcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCA_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT
Motif
Other DBs
NCBI-ProteinID: AFB21076
Position
complement(574674..575930)
Genome map
AA seq 418 aa AA seqDB search
MPIKILMPALSPTMTEGNLSRWLKNEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEDIDDINGFIAKNSSVLPSLKADADANRLKSTEDIAVQY
SNVEEQVAVTNHNKSKIFASPLAKRLAKIQNIRLESVKGSGPHGRIIKQDILSYTPSTVP
NKIVIRNPEEYHLVPNNNIRKIIAKRVLESKQTVPHFYLSIECNVDKLLEIREDINKSFS
EDNSTRISVNDFIILAIAKALQEVPNANASWGKDAIRYYNNVDIAVAVAIENGLVTPIVK
NADQKNIIELSHEMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKHFNAIINPPQSCI
MAVGSSSKRAIVKNDQINIATIMDVTLSADHRVIDGVVGAEFLAAFKKFIERPALMLL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctatct
aggtggttaaaaaatgaaggggacaaagttaatcccggggaagtaattgccgaaattgaa
accgacaaagcaacgatggaagtagaagcagtagacgaaggtatactggctaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgctgtgttaagcgaagag
ggagaagacatagatgatattaatgggtttattgcaaaaaatagtagtgtattaccatca
ctgaaagcagatgcagatgctaatcgtctaaaatccactgaggatatagctgtgcaatat
tctaatgtagaagagcaggtagcagttacaaatcataacaaaagtaaaatattcgcctca
ccccttgcgaaaaggcttgcaaaaattcaaaatattagacttgagagtgtaaaaggtagt
ggtccgcacggtagaataatcaaacaagatattttatcatatactcctagcactgttcct
aataaaatagttattaggaatcccgaagaatatcatttagtaccaaataataatattcgc
aagattatagctaaacgtgtacttgaatctaaacaaacagtcccacatttctatttatcg
atagaatgtaacgttgataaattattagagataagagaagacattaataaatctttttct
gaagataattcaacaaggatatcggtcaatgattttattattttagcaatagccaaagct
ttgcaagaagtgccgaatgctaatgctagttgggggaaagatgcgattagatattacaat
aacgtggatattgcggtagcagtagcgattgagaatgggcttgttacgccgatagttaaa
aatgctgatcaaaaaaatattatcgagctatctcatgaaatgaaagaattaataaagaaa
gcaaaagataataaattaacccctgaagagtttcaaggtggaggatttactatttctaac
ctcggtatgtacggtattaagcattttaatgctataataaatccaccgcaaagttgtata
atggcggttggtagcagctcaaaacgtgctatagtcaaaaatgatcaaataaatatagca
acaattatggacgtaactctttctgctgatcaccgagtaatagacggagtagtcggtgcc
gagttcttggcagcatttaagaagtttatagaaagaccagctttgatgttgttataa

DBGET integrated database retrieval system