KEGG   Rickettsia canadensis CA410: RCA_05195Help
Entry
RCA_05195         CDS       T01736                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rcc  Rickettsia canadensis CA410
Pathway
rcc00230  Purine metabolism
rcc00240  Pyrimidine metabolism
rcc01100  Metabolic pathways
rcc03030  DNA replication
rcc03430  Mismatch repair
rcc03440  Homologous recombination
Module
rcc_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RCA_05195
   00240 Pyrimidine metabolism
    RCA_05195
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RCA_05195
   03430 Mismatch repair
    RCA_05195
   03440 Homologous recombination
    RCA_05195
Enzymes [BR:rcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RCA_05195
DNA replication proteins [BR:rcc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RCA_05195
DNA repair and recombination proteins [BR:rcc03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     RCA_05195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AFB21582
Position
complement(1135562..1136026)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSVLLLIEKCYYSDLKSIILTTDKEQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLIIISPIDIGKILQVKDYIEVFKRIIIITHFLE
DLKELTVKVNKFTEQENKIDCFKQDMRGAWNKVK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattactgctaaaatcggtattactt
ctgatagaaaaatgttattactctgatcttaaaagtattatacttaccactgataaagaa
cagcaggaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaagcttgatccacagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttatcattatttcacccatagatataggaaaaatttta
caagttaaagactatatagaagtttttaaaagaataattattataactcattttctggaa
gatttaaaagaattaacagttaaagtaaataaatttactgagcaggaaaataaaatcgat
tgttttaaacaagatatgcggggtgcatggaataaagtaaaataa

DBGET integrated database retrieval system