KEGG   Rickettsia canadensis CA410: RCA_05245Help
Entry
RCA_05245         CDS       T01736                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rcc  Rickettsia canadensis CA410
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RCA_05245
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RCA_05245
Enzymes [BR:rcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RCA_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143095..1143874
Genome map
AA seq 259 aa AA seqDB search
MKDKVAVITGSTSGIGLKIAKHFAKLESKIVINGFTKEDEVAKISAELKELGASSVFYQG
INLEKPDEIRSMFEKIIKEFGKIDILVNNAGIQHVAPIDEFPEDKWEQILRIDLIASFYT
TKYVIPIMKKNGFGRIVNIASAHAYVASPFKSAYVAAKHGVLGLTKTIALEVAENNITVN
AICPGYVNTPLVKNQIADTAKARNISEESALQDVILKSHATKKFVEADEIANLVIFLCDE
KASSITGSGLLIDGGWTAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaaagtagcagttattaccggttctactagcggtatcggtcttaagatagca
aaacattttgcaaaacttgagtctaaaatagttattaacggttttacaaaagaagatgaa
gtagccaaaatttcagcagaattaaaagaacttggtgcaagtagtgtattttatcaagga
ataaatttggaaaagcctgatgaaattcgttctatgttcgagaaaataataaaagaattc
ggcaaaatagatatattagtaaataacgcaggtattcaacatgttgcccctatcgatgaa
tttcctgaagataaatgggagcaaatactacgcatagatttaatagcttctttttatact
acaaaatacgtaataccaattatgaaaaaaaacggctttggacgaatcgtcaacatcgct
tccgctcatgcatatgttgcatcaccatttaagtcagcatatgtagcagcaaagcacggt
gttcttgggcttaccaaaaccattgctttagaagtggctgagaataatattacagttaat
gctatttgcccgggttatgttaatactcccttagtcaagaatcaaatagcagatactgct
aaagctagaaatattagtgaagaatcagcattacaagatgtaatcctaaaatctcacgcc
acaaaaaaatttgtcgaagctgatgaaatagcaaacttagtaatattcttatgtgacgaa
aaagcatcatcaataacaggtagtggactcttgatagatggcggctggacggcacagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system