KEGG   Rhodospirillum centenum: RC1_0014Help
Entry
RC1_0014          CDS       T00785                                 

Definition
(GenBank) transcriptional regulator, LysR family protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like PBP_like_2 Cro MarR_2
Motif
Other DBs
NCBI-ProteinID: ACI97465
UniProt: B6IPS9
Position
complement(6093..6971)
Genome map
AA seq 292 aa AA seqDB search
MTLDQLRIFVAVAEREHVTRAAQALNLAQSAVSHAIAALEAQHQVRLFERRGRGIVLTEA
GIVLLTEARTLLAQVGMIELALSDFSALKRGTLSLHASQTIASYWLPRHLAAFHAAHPQV
RIRLEIGNSAAVVAAVQAGTAELGFVEGDGETGGLARRPVARDRLLVVVGPGHPWADGRR
LAPADLAGSDWVLREPGSGTRAMFEDALIRAGVAPSALRIALELPSNEAVRGVVEAGLGA
TCLSASVAAAGLEAGLLRQAGVDLPDRRFHLLHHPGRPRSRAALAFAAQVEP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggaccagctccgtatcttcgtggctgtcgccgagcgggagcacgtcacccgc
gcggcgcaggcgctgaacctcgcacagtcggcggtcagccatgccatcgcggcgctggag
gcgcagcaccaggtccggctgttcgagcgccggggccgcggcatcgtgctgacggaggcg
ggcatcgtgctgctgaccgaggcgcggactctgctggcccaggtgggaatgatcgagctg
gcgctcagcgatttcagcgcgctgaagcgcgggaccctgtcgctccatgccagccagacc
atcgcctcctactggctgccccgccatctggccgccttccacgccgcccacccgcaggtc
cgcatccggctggagatcggcaacagcgccgccgtcgtggccgccgtgcaggcggggacg
gccgaactgggcttcgtcgagggagacggggagacgggtggcctggcccgccggccggtg
gcccgcgaccggctgctggtcgtcgtcggtcccggccatccctgggccgacggccgccgc
ctcgcccctgccgatctggccgggagcgactgggttctgcgggaaccggggtcgggaacc
cgcgccatgttcgaggatgcgctgatccgggccggcgtcgccccgtcggcgctgcggatc
gcgctggaactgccctccaacgaagcggtgcggggcgtggtggaggcggggctgggcgcg
acctgcctgtccgcctccgtcgccgctgccgggctggaggcgggactgctgcgacaggcc
ggggtcgatctgcccgaccgccggttccacctgctgcaccatcccggccgtccccgcagc
cgggccgccctcgccttcgccgcccaggtggagccctga

DBGET integrated database retrieval system