KEGG   Rhodospirillum centenum: RC1_0023Help
Entry
RC1_0023          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(12634..12759)
Genome map
AA seq 41 aa AA seqDB search
MEPDLPGEVLLGLAFVEEARPWRDCWPSLSVAGEVPRAGWG
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgacctgccgggggaagtactgctgggtctcgccttcgtggaggaggcccgg
ccctggcgcgactgctggccgagcctctccgtggccggggaggtgccccgggccggctgg
gggtaa

DBGET integrated database retrieval system