KEGG   Rhodospirillum centenum: RC1_0026Help
Entry
RC1_0026          CDS       T00785                                 

Definition
phosphodiesterase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rce  Rhodospirillum centenum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rce00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rce00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rce02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(15740..16894)
Genome map
AA seq 384 aa AA seqDB search
MSDTDPDRRRLLTGMAAAPLALATGLRADGTQAEGAAAGPAPYPAADEGRTIRRIAFGSC
AKSEKEQPIWDAIVAAEPDLFIFLGDNVYLDTRDPEVMRRKYAALAAKPGFQKLRARTPV
IAIWDDHDYGENDAGADYPMKEESRRQFCDFFGVPADSPRRTRDGIYTSVTFGPPGRRLQ
VLLPDLRWNRTPIRTLDLGGTPYDTWADEQARAGRPVPGPYARNPEDPATMLGERQWQWL
EQQLARPADVRILASSLQVVADFPGWEAWINYARDHQRLIQAIREKRADGLFCISGDTHY
AEISRLDVNVPYPLWDFTSSGLTEVWPVLPPNARRRGEAYRAENFGLIEIDWRDGNTIVT
VQIRDIVGAVRLEQRLRVADLAVP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaccgatccggaccgccgccggttgctgaccggcatggcggccgcccccctc
gcccttgccaccggcctgcgggccgacggaacccaggccgagggggccgccgccggaccc
gccccctatcctgccgccgacgagggccgcaccatccgccgcatcgccttcggctcctgc
gccaagtcggagaaggagcagccgatctgggacgccatcgtggcggcggaaccggacctg
ttcatcttcctgggcgacaatgtctatctggacacccgcgatcccgaggtgatgcgccgc
aagtacgcggccctggcggccaagcccggtttccagaaactgcgggcccgcaccccggtc
atcgccatctgggacgaccacgactacggcgagaacgacgccggcgccgactatccgatg
aaggaagaatcgcggcggcagttctgcgatttcttcggcgtgccggccgattcaccccgg
cgcacccgggacggcatctacaccagcgtcaccttcggcccgccgggccggcggttgcag
gttctgctgcccgacctgcgctggaaccgcaccccgatccgcaccctggacctcggcggc
acgccctacgacacctgggcggacgaacaggccagggccggccggccggtgcccggcccc
tatgcgcgcaatcccgaggatccggccaccatgctgggggagcggcaatggcagtggctg
gaacagcagctcgcccggccggcagacgtgcgcatcctggcgtccagcctccaggtcgtg
gccgacttccccggctgggaggcctggatcaactatgcccgcgatcatcagcggctgatc
caggcgatccgcgagaagcgggccgacgggctgttctgcatctccggcgacacccattac
gccgagatctcccgtctggacgtgaacgtcccctatccgctgtgggacttcacctcctcc
ggcctgacggaggtctggccggtgctgccgcccaatgcccggcgccggggcgaggcatac
cgcgccgagaacttcggcctgatcgagatcgactggcgggacgggaacacgatcgtcacc
gtgcagatccgcgacatcgtgggcgcggtccggctggaacaacgcctgcgcgtcgcggat
ctggccgtgccgtga

DBGET integrated database retrieval system