KEGG   Rhodospirillum centenum: RC1_0033Help
Entry
RC1_0033          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
24541..25305
Genome map
AA seq 254 aa AA seqDB search
MPIGDNEFETVAKGDLPALLASSSDDDLDFLVSYILNASTESLSSKDEYKRHRPKHSRYT
DLIAAEIREFGGNTFANLFRGEGPFYAEVVVDVCEQLKVKPGGDVVENEKKILMKIVEDS
WEKLSPEKREEFLDEIRKAGHKGASLSAAMPLSVIMAQLSVRLAGFMAYRMAMVAANAVA
RQVLGRGLALAVNAGLARAIGAFAGPIGWIVTGLWTAIDLAGPAYRVTIPCVIHVAYLRQ
KLLFEALAASADFE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcggcgacaacgaattcgagacagtggccaaaggcgaccttcccgccctcctc
gcgtcttcctcggacgacgacctggatttccttgtctcgtacatcctcaacgcgagcacc
gagtcgctttcgtccaaggacgagtacaagaggcaccgccccaagcattcgcgctacacc
gacctgatcgcggcggagatccgggagtttggaggcaacacgttcgccaacttgttccgc
ggcgagggccccttctacgccgaggtggttgtcgacgtctgcgagcagctcaaggtcaaa
ccaggcggggacgtcgtcgagaacgagaagaagatcctcatgaagatcgttgaggactcc
tgggaaaagctgtccccggagaagcgggaggagttcctggacgagatcaggaaggcgggc
cacaagggcgcgtccctgtcggccgccatgcccctttcggtgatcatggcccagttgagc
gtccgcctcgcagggttcatggcctaccggatggcgatggtcgccgccaacgcggtcgcc
aggcaggtgctcggacgcgggctggctctcgcggtcaacgccggccttgccagggcgatc
ggcgcgttcgcaggtcccataggatggatcgtcaccggactgtggaccgcgatcgacctc
gccggtcccgcctaccgggtcaccattccctgcgtgatccacgtcgcctacctgaggcag
aaacttctgttcgaggccctcgccgcctcggccgacttcgagtga

DBGET integrated database retrieval system