KEGG   Rhodospirillum centenum: RC1_0036Help
Entry
RC1_0036          CDS       T00785                                 

Gene name
gin
Definition
(GenBank) Gin (G segment invertase), phage site-specific recombinase, resolvase
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase Recombinase
Motif
Other DBs
NCBI-ProteinID: ACI97486
UniProt: B6IPV0
Position
complement(26786..28126)
Genome map
AA seq 446 aa AA seqDB search
MRRTSTPATPVQRRLRCAIYTRKSSEEGLDMEFNSLDAQREACESFIASQKAEGWVALRD
RFDDGGFSGGTLERPALQRLLADIEAGLVDVVVVYKIDRLSRALMDFARLVEVFDRHGVT
FVSVTQSFNTTTSMGRLTLNILLSFAQFEREVIGERIRDKFAASRARGMWMGGYVPTGYD
VKDRKLVVNEAESATIRMIFERFVQLGSATTLVAQLAAEGVVTKRGKPVDKGFLYKLLNN
RVYLGEAVHKGTSYPGEHAAIIDQDLWNRVHGILQESPRSRAAATRTQTPALLKGLIFGP
TGTAMTPTATKKGSRLYRYYASMDVIRGRMSGTESTAPQRLPAEMVENAVVREVRRLVRT
PEIVAQTVAAARRDDAGVTEHDVVTALDRFDEVWSALFPAEQARLVRLLVDRVTVTADGI
AVDLRTAGLGSVVREMLTPRTPEAVA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggacgagcacgccggcgaccccggtccagcgtcggctgcgctgcgccatctac
acccgcaagtcgagcgaggaaggtctggacatggagttcaacagcctcgacgcccagcgc
gaggcctgcgagtccttcatcgccagccagaaggctgagggctgggtggcgctgcgcgac
cgcttcgacgacggcggcttctccggcggcacgctggagcgcccggccctgcaacgcctg
ctcgccgatatcgaggccgggctggtggacgtggtggtggtctataagatcgaccggctg
tcccgcgccctgatggatttcgctcggctggtcgaggtgttcgaccgccacggcgtcacc
ttcgtctcggtgacccagagcttcaacaccaccacctcgatgggccggctgacgctcaac
atcctgctcagcttcgcccagttcgagcgcgaggtgatcggcgagcgcatccgcgacaag
ttcgccgcctcgcgggcgcgcggcatgtggatgggcggctacgtgcccaccggctatgac
gtgaaagaccgcaagctggtggtgaacgaggccgaatccgccaccatccgcatgatcttc
gagcgcttcgtccagcttggatcggccaccaccctggtggcgcaactggccgccgagggc
gtcgtcaccaagcgcggcaagccggtcgacaagggctttctctacaaactgctgaataac
cgggtctatctcggcgaggcggtccacaagggcacgtcctaccccggtgagcatgcggcg
atcatcgatcaggatctgtggaatagggtccacggcatcctgcaggaaagtccgcgctcg
cgcgccgccgccacgcggacgcagacgcccgccctgctgaagggcctgatcttcggcccg
acgggcacggccatgacgccgaccgccacgaagaagggcagccggctctatcgctactac
gcctcgatggatgtcatccgcgggcggatgtccggcacggagtccacggcaccccagcgg
ctgccggcggagatggtcgagaacgctgtggtgcgggaagtgcgccgcctcgtccggacg
cccgagatcgtggcgcagaccgtggccgcagcccgccgggacgacgccggcgtgacggag
catgacgtggtcaccgccctcgaccggttcgacgaggtctggtccgccttgttcccggcc
gaacaggcccgtctggtgcggttgctggtcgaccgggtcaccgtcaccgccgacggcatc
gccgtcgacctgcgcaccgccggactcggctcggtggtgcgcgagatgctaaccccgcgc
accccggaggccgtcgcatga

DBGET integrated database retrieval system