KEGG   Rhodospirillum centenum: RC1_0038Help
Entry
RC1_0038          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_22
Motif
Other DBs
NCBI-ProteinID: ACI97488
UniProt: B6IPV2
Position
complement(28632..28823)
Genome map
AA seq 63 aa AA seqDB search
MDKPLSGPNALAPDRMTAEERLAEVGRLLAAGLLRIRGGDIRLDFPPTQRGGGREPRSQA
GGR
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacccctcagcggccccaacgccctcgcccccgaccgcatgacggcggaggag
cggttggccgaggtcggccggctgctcgccgccggccttctgcgcatccgcggcggagac
attcgcctggacttcccgcccacacagcgcggtggtggtcgcgaaccacgctcccaggct
ggaggacgatga

DBGET integrated database retrieval system