KEGG   Rhodospirillum centenum: RC1_0040Help
Entry
RC1_0040          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M78 SprT-like Peptidase_M48
Motif
Other DBs
NCBI-ProteinID: ACI97490
UniProt: B6IPV4
Position
29565..30194
Genome map
AA seq 209 aa AA seqDB search
MTRLLRGRRSESLYPITTDELTILIEQNNAGLDAYADLSDFGADVEGVTIFHPDRDPEIL
ISDRLANDERRENRLRTTLAHEFGHLHFHRHLWADKLAARRLFDRLSRDNKAICKRDTIL
NARDVDWMEWQAGYVSGAILMPLTAVRRLVSDYCGPRNLHAAVSVASEHGRQIVAHVMET
FQVSEDAARVRLLKLGQLTASDRQPSLFG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggctgctgcggggccgccgcagcgaatccctttatccgatcaccacggatgag
ctcacgatcctgatcgagcagaacaatgctggactggatgcgtacgccgacctgtccgac
tttggtgccgacgtggagggcgtcaccatcttccatccggatcgggaccccgaaatcctg
atctccgaccgcctcgccaacgacgagcgccgggagaaccggctgcgcacgacgctggcg
catgaattcggccatcttcacttccatcggcatctgtgggcggacaagctcgccgcacgc
cgcctgttcgatcggctgagccgcgacaacaaggccatctgcaagcgtgacaccatcctg
aatgctcgcgatgtcgattggatggagtggcaggccggctatgtcagtggggcgatcctg
atgccgctgacggcggtccgccgtctggtgtcggactattgcggacctcggaacctccat
gcggccgtatccgtcgcctcggagcacggacggcagatcgtggcccacgtcatggagacg
ttccaggtgtccgaggatgccgcccgggtgcggctgctcaaactgggccaactgaccgcc
tcggaccggcagccgtcgctgttcgggtaa

DBGET integrated database retrieval system