KEGG   Rhodospirillum centenum: RC1_0042Help
Entry
RC1_0042          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
31782..32414
Genome map
AA seq 210 aa AA seqDB search
MFMAQLLASLDRRSAGTVPLIPELLWEVGDVRLGRRPQRVPLWFARRLHDQAVWRQVKGV
AQARPAPGLRVLLTSTAFRRVPDEGVAGHEIISVPDVIDHNAGVALHPEILAARVGGRDH
RSDGPLAHTADFTVVTVHGKDYPFRGAKQRDLVRQLVDAFQRGAPRCLTAKVLEEANYNS
SVNTIAKAFSGRDDWREFIAEDGGSCWIFT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgttcatggcgcagttgctggcctccctcgaccggaggtcggccggtacggtgccgctc
attcctgaactcttgtgggaggtcggagacgttcgcctcggtcgcagacctcagcgggtg
cccttgtggttcgcgcgccgactccatgatcaggccgtatggcggcaggtcaagggcgtg
gcccaggcccgacccgcgcccggtcttcgcgtgttgctcaccagcaccgcattccgccgc
gttccggacgagggggtggcgggacacgagatcatctccgtaccggatgtgatcgatcac
aacgccggagtcgcccttcacccggagatcctggcggcccgtgtcggtggcagggaccat
cggagcgatggtcctctggcccacaccgcggacttcacggtcgtcaccgttcatggcaag
gactaccccttccgcggcgccaagcagcgggatcttgtccgtcagcttgtggacgcgttt
cagcgtggcgccccgcggtgcctgacagcaaaagtcctggaagaggccaattacaacagc
tcggtcaatacgatcgccaaggccttctcgggaagggatgactggcgggagttcatcgcc
gaggacggcggatcctgttggatattcacctga

DBGET integrated database retrieval system