KEGG   Rhodospirillum centenum: RC1_0044Help
Entry
RC1_0044          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI97494
UniProt: B6IPV8
Position
32871..33176
Genome map
AA seq 101 aa AA seqDB search
MQTPDPTRTLVADETALLDWLRTAQPGDRFLYHIGHLAADRVRGSAGLTDPQREALCRLA
DRVLALVTEDALTAAQRRRADGHMAYLAIKTSGRKAGRRFP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacccgatcccacccgcaccctggtcgccgacgaaacagcgctgctggactgg
ctccggaccgcgcagccgggtgaccgcttcctctaccacatcggccacctcgccgccgac
cgcgtgcgcggcagcgccggcctcaccgacccgcagcgggaggcgctgtgccggctggcc
gaccgcgtcctggcgctggtcaccgaggacgcgctgacggccgcgcagcgccgccgcgcc
gacgggcacatggcctatctcgcgatcaagacgtccggccgcaaggccggcaggaggttt
ccatga

DBGET integrated database retrieval system