KEGG   Rhodospirillum centenum: RC1_0050Help
Entry
RC1_0050          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
36060..36275
Genome map
AA seq 71 aa AA seqDB search
MMDLNDDGPAGEWLQLLEAADANAETDFEIAFCESLREKFETYGSRARLTDAQDRKLRCI
AQGGGFWERGA
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctgaacgacgacggaccggccggggagtggcttcaactgctcgaggcggcc
gatgccaacgctgagaccgacttcgagatcgcgttctgcgagagcctgcgggagaagttc
gagacctacggcagccgcgcccggctgaccgacgcgcaggaccgcaagcttcgctgcatc
gcgcagggcggcggcttctgggagcgcggcgcatga

DBGET integrated database retrieval system