KEGG   Rhodospirillum centenum: RC1_0051Help
Entry
RC1_0051          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI97501
UniProt: B6IPW5
Position
36272..37069
Genome map
AA seq 265 aa AA seqDB search
MIDLNHGSGCQYEGPARPPDLAAAVNTAIDAILVARNRAQPPRRYVSTSGIGRECLRQIQ
YDYLAVPKDAGADFTGATLRIFDAGHRGEDVVADWLRAAGFDLRTHRRDGRQFGFAALGG
RFKGHIDGCLVAGPAAMAYPALWENKCLGAAPWKEVVKRGVVLARPVYAAQIALYQAYMD
LAEPALFTALNRDSWELHAELVPFDAPLAQRMSDRAVEVVQASAVQELLPRAAAHRTSAL
CRGGWTGGEWHAPCPWQDRCWGPAP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctcaaccatgggtccggctgccagtacgaggggccggcccgtccgcccgat
ctggccgccgcggtcaacaccgccatcgacgccatcctggtcgcccgcaaccgggcgcag
cccccacgccgctacgtcagcacctcgggcatcggccgcgaatgcctgcgccagatccaa
tacgactatctcgccgtgccaaaggatgcaggggctgatttcacgggcgccactctgcgc
atcttcgatgccggccatcgtggcgaggacgtcgtcgccgactggctgcgcgccgccggc
ttcgacctgcgcacgcaccgccgggacgggaggcagttcggcttcgcggcactgggcggg
cggttcaagggccacatcgacggctgcctcgtcgccggacccgccgccatggcctatccg
gccctgtgggagaataaatgcctgggggcggccccgtggaaggaggtggtcaagcggggt
gtcgtccttgcccggccggtctacgcagcacagatcgcgctttatcaggcctatatggac
ctagccgaaccggccctgttcacggcgctgaaccgcgacagttgggaactgcacgccgaa
ctggtgcccttcgacgcgccgctggcccagcgcatgagcgaccgggcggtggaggtggta
caggcatccgcggtgcaggaactgttgccccgtgccgccgcccaccgcacctcggcgctg
tgccgtggcggctggaccgggggcgaatggcacgcgccttgcccatggcaggaccgttgc
tgggggcctgcgccatga

DBGET integrated database retrieval system