KEGG   Rhodospirillum centenum: RC1_0053Help
Entry
RC1_0053          CDS       T00785                                 

Definition
(GenBank) virulence-associated protein E, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
38385..40913
Genome map
AA seq 842 aa AA seqDB search
MIDLNDVWQPPPRFDLRQVRDRLAASAPDWLPPLFPRGRLSADRRTLRCADLSGRPPRNE
GSCVLHLVGSHAGWGFDFATGESAGPIDLIHYATGLEDGPLFEEAVRLARMDLPVSAPRP
ASGRPDHSLEVARILDGCRPLAGTVAETYLRSRGLADPGSPDLLYHDDLADRDTARGWPG
LVAVVRDGAGQPTGGIHRTFLLDDGSCKAPPGKKMLGPIANGHVRLAPLGADGHLGVAEG
IETALAATAIFGIPTWAGLSADGVRRFQWPEGTSQITIFADAGDAGRQAAAALADRLNRA
DILNSIVVPLHGDDFNDDLRQGKSAADYSLEPAAQPARTLNTLAEMEAAALALTCPPDMT
DLARLLGAIATARLDPVPIRHLLTTIKATTRIPVSVLEKQLRDLRRRLNGGGGDAPAIRS
PWAAMLRIGDDGTPERNEANVITALSNDPAFAGALVFDEFRQEILAARPLPWESAPFPAA
RPWNATDDVRCAEWLQRREINVTPLVVSRSVGAVANDIRVHPVRDYLDHLRWDGTARLET
WAIRYLGAKDTPLSHAFGARWLISAVARILRPGAKVDHMLILEGPQGTGKSTALKVLAGE
DWFTDELAEIGSRDCAQQMRGVWIIEIAELDAIGRAEVERIKAFLTRTTDRYRPPYERYV
IDVPRQCVFAGSVNPDTYLRDETGNRRFWPLRCGRIDLDALRQDRDQLWAEAVARFRDGA
IWWLDDPDLIAAARIEQEARYQGDAWDARIDRWLTHERRRINRGYAGYDDWRDEEVERDR
PVCDVSVGEILEGALGIETGKWSRGDQMRVAAYLKARQWERYKAGAGGRREWRYRRPTWL
AD
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctcaacgacgtctggcagccgccaccccggttcgacctgcgacaggtccgc
gacaggctggcggcgtccgcgcccgactggctgccgccgctgttccccaggggccgcctc
tccgccgaccgacgcaccctgcgctgtgccgatctctccggccggccgccgcgcaacgag
ggctcctgcgtgctgcacctggtgggcagccatgccggctggggtttcgacttcgccacc
ggcgagagcgccggacccattgacctgatccactacgccaccggcctggaggatgggccg
ctgttcgaggaggcggtccggctcgcccgtatggacctgccagtgtcggcgccgcggccc
gcttcgggcaggccggaccacagcctggaggtcgcccgcatcctcgacggctgccgcccg
ctcgccggcaccgtggccgaaacctacctgcgcagccggggactggccgatccgggatcg
ccggacctgctctatcacgacgatctcgccgaccgcgacaccgcgcgcggctggcccggc
ctcgtggcggtggtgcgcgacggcgccggccagcccaccggcggcatccaccgcaccttc
ctgctcgacgacggctcgtgcaaggcgccgccgggcaagaagatgctggggccgattgcg
aatgggcatgtccggctggctccccttggcgcagacggtcatctgggcgtggccgaaggt
atcgagacggcgctggccgcaacggcgatcttcggcattcccacctgggccggtctgtcc
gcggacggcgtgcgccggtttcaatggccggagggcacaagccaaatcaccatcttcgcc
gacgccggggacgctggccgccaagccgccgctgcgctggctgaccggctgaaccgggcg
gacatcctcaactctatcgtcgtcccgctgcacggcgatgatttcaacgatgatctgcgg
caggggaagagtgccgctgactatagcctggagcctgccgcgcaacctgcccggacgctc
aacaccctggcggagatggaagccgccgccctcgcgctcacctgtccgcccgacatgacg
gaccttgcccgccttctgggtgccatcgccaccgcgcggctcgaccccgtgcccatccgg
cacctgctgaccaccatcaaggccaccacccgcatcccggtctcggtgctggagaagcag
cttcgcgacctgcgccgccggctgaatggcggcggcggtgacgcgccggcgatccgttcg
ccctgggccgccatgctgcgcatcggcgatgacggcacgccggagcgcaacgaggccaat
gtcatcaccgccctgtccaatgatccggccttcgccggggccctggtcttcgacgaattc
cggcaggagattctggcggcccgcccgctgccctgggaaagcgccccgttcccggccgcg
cgcccctggaatgccaccgacgacgtgcgctgcgccgaatggctccagcgccgcgagatc
aacgtcacgcccctggtggtcagccgcagcgtcggcgcggtggccaacgacatccgcgtc
catccggtgcgtgactatctcgatcatctgcgctgggacggcacggcgcggctggagacc
tgggccatccgctatcttggcgccaaggacacgccgctcagccacgccttcggcgcccgc
tggctgatctccgccgtcgcccgcatcctgcggccgggcgccaaggtcgaccacatgctg
atcctggaagggccgcagggtaccggcaaatcgaccgcgctgaaggtcctggccggcgag
gactggttcaccgacgaactggcggagatcggcagcagggactgcgcccagcagatgcgc
ggcgtctggatcatcgagatcgccgaactggacgccatcggccgggccgaggtcgagcgc
atcaaggccttcctgacccgcaccaccgaccgctaccgcccgccgtacgagcgctacgtc
atcgacgtgccccgccagtgcgtcttcgccggttccgtcaacccggacacctacctgcgc
gacgaaaccggcaaccgccgcttctggccgctgcgctgcggccgcatcgacctggacgcc
ctgcggcaggaccgcgaccagctttgggccgaggcggtggcccgtttccgcgacggcgcc
atctggtggctggacgatcccgatctgatcgccgccgctaggatcgagcaggaagcccgc
taccagggcgacgcctgggacgcccgcatcgaccgctggctgacccacgagcgccgccgc
atcaaccgcggttatgccggctacgacgactggcgcgacgaggaggtcgagcgcgaccgg
ccggtctgcgacgtttccgtgggtgaaatcctggaaggggcgctggggattgaaacggga
aagtggtcacggggcgaccagatgcgcgtggcggcgtatctgaaggcccggcagtgggag
cggtacaaggcaggagcgggtggtcggcgggaatggcggtatcggcggccgacttggctg
gccgattga

DBGET integrated database retrieval system