KEGG   Rhodospirillum centenum: RC1_0054Help
Entry
RC1_0054          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(40915..41577)
Genome map
AA seq 220 aa AA seqDB search
MEGRSDVLFLKLAAKLYREERGIDVFNDFGVLAAGDGDDGGVDGVNRRLSAARQLAEYDL
TPAGAKRYRFIGLFDNDEAGRRALKRACNFDPRVVRYEDVFLLHPVMPIAGGSPGSVVEK
RAETLNYDFRRLDWEVEDLFSPDFLRAFVADYPNAVVHETTIGGRTHRDLSRDGKTALRE
FAEKYATLDDVIDLIRLICSLRDYLHLQHNHILPTQGDSG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttggaagggcgaagcgacgtcctcttcttgaaacttgccgcaaaactgtaccgagaagaa
cgaggaatcgacgttttcaacgatttcggggtgttggcagcaggtgatggagatgacggc
ggagtcgatggtgtcaaccgccggctgagcgcggcacgacagctcgctgaatacgacctg
acacccgcgggagcgaaaaggtaccgcttcattggccttttcgacaatgacgaagccggt
cgccgggccctaaaacgcgcctgtaatttcgatccacgcgtagtgcgttatgaagatgtc
tttctgctgcatcccgtcatgcccatagccggcggctctccaggatcggtcgtcgagaaa
agagccgaaacgctcaactacgacttcaggcggctggactgggaagttgaagacctgttc
tcgccagattttctgcgggctttcgtggccgactatcctaacgctgtggttcatgagaca
acgatcgggggacggacacaccgggatctaagccgagatggaaaaacggccttgagagag
ttcgcagagaagtatgcaactttggatgatgtgatcgacttgattcgattgatctgttcc
ctgagagattatcttcacctgcagcacaaccatattttgcctacccagggggattccgga
tga

DBGET integrated database retrieval system