KEGG   Rhodospirillum centenum: RC1_0055Help
Entry
RC1_0055          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI97505
UniProt: B6IPW9
Position
complement(41647..45231)
Genome map
AA seq 1194 aa AA seqDB search
MLVSAVPTPIKRLGPVGTIGEGKSVVTTAGLVPTSADVGSRMGVVRAGVFPEQAASDRRS
LDLVNYPSRCPPFFTTLPCKLLFLILNCARKKRTIPTSEVACRHGPVRSPLGPRCPRATV
GPYARSHSLRNTFMSDGVHHQAEAPASLFAELDSRDVAVWLQEPFAAAAGPEKAAKVLGL
PWAFVFSESSDQALITALEATESVESPLVRRRGIIHIVDTNPSDVPLPPRSLPVFLLNGR
GGTRNSGLAALTRRLTMLEELQRRSIKHLVVLGGPTFALPQELTGLWAEGFRSFTTVVSD
ASDATDKAAAWRAETGARTISLVTTAAGAFVDDLVRRYMEGRDERQILRLRDATETLHRL
DVTGLDDPEHPLLGRYELLTEEHLIPLLPDDLRVEDVEGFFKDPRSSWRPFAAGMPWPRE
PDALNILKRALRKLDREAGESNPLFYVSAESGAGATTFIRNLAWETASEGYPTLLAAAAP
FTPSSVEVTSYMSRCMETATKTGIGADTRLYQAPWLIVFDRTALNGHEDDLIHFSRELEK
SGRRACIVFVTDSVLPIAIYEGSRFKRLAVLTHQVSKPDAVELGRHLNRYLLKHGTVRSE
AEWNNFLQRSIVGPGNGYAAFWIALSFWLRRLFDMEETIQSWLYYQFHEKVTDPVLRHAI
IDIAAMSTVHRPLPEVLLPASHDWPTADKLCDIQSGLGALGIVRGIDSTQRYWALIHDLL
GRFLLTALFYDRPALEAAGFGEATNPEHLRLLVLKRIARLPGLAHRGLREVAEAFATSIF
KIDPSHGHALFAPYWREALVALDEMPRAFRTTSRAFLHHAAISRRRIAKDKSAFDISDDE
RAELLSRAISDIETALSITGDADGESDMNLLNSLAHAYHDLAEVEVQRRAKQERIQDLQT
KARDATRRAYRLSPDNSFVVETYARDLLTGARSDPTATAGNAIEVLGLVYAAMQRGAAEA
RRFALGRLAEAALDVLLEVAGEFDERSNPQTESDAIIVALKSLAEGVRRFEGMELNDYPA
TNRIRAAEHLANPILRSNAQAVRLQYLLCCMDRPQDFAQQLEFLESLKGSSSTFTPQMDL
ELAVLLHQRDRHHEAARKFHELRQRWQREEHFVEVPERLKWLRVRDRDDRRQVRARISQT
GDGRHRARVSEMQGVEVTFRPQEFGREKLRPGMVINGYISFGHNGPFLRPLTAN
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgctggtttcagcggtcccaacccccatcaagaggttgggaccggttgggaccataggg
gaagggaaatccgtggtgactacggcaggtttggtcccaacctctgccgatgtcgggagc
cgcatgggcgtggttagggccggggtgttcccagagcaagcagcgtcagaccggcggtcg
ctcgatctagtaaactatccttcccgttgtcccccctttttcaccaccctgccttgcaag
ctcctattcctgatcttgaactgcgccagaaaaaagcggactatccccacctcggaagtg
gcatgccgccacggccccgttcgcagtcctctcggaccgcgttgtcccagagcaacggtc
ggaccatacgcccgctcgcacagcctccggaatacgttcatgagcgacggagttcaccac
caagccgaagcaccggcgtcgctattcgccgaacttgactcacgcgacgttgcggtctgg
ctccaggagccattcgctgctgctgcgggaccggagaaggcggccaaggttcttggcctg
ccgtgggccttcgtcttcagtgaatcttccgaccaagcgctgatcaccgcgcttgaggcg
acggagtcggtggagagtcccctcgtcagacggcgcggcataattcacatcgtcgacacc
aacccgtctgatgtcccgctaccacctcgtagccttccagtgttcctgctcaacgggcgc
ggaggcacccggaattcggggctagccgcccttacccggcgactgacgatgctggaggaa
ctccagcggcggtcgatcaagcatctcgtagtcctaggtggtccgactttcgccctgccg
caggagctaacagggttgtgggcggagggcttccgctccttcacaaccgtcgtcagcgat
gcctccgacgccacggacaaagcggccgcgtggagagccgagacgggcgcgcggacaatc
agccttgtcacgacagccgccggggctttcgtcgacgatctggtgcgtcgctacatggaa
ggccgcgacgagcggcagattcttcgcctgcgcgacgccaccgagaccctacaccgactc
gacgtcaccggtctcgatgatcccgaacacccgctcttgggacgctacgagctcctcacg
gaggaacacctcattccgcttcttccggacgacctgcgcgtcgaagatgtcgagggtttt
ttcaaagatccgcgttcctcttggcggccctttgccgcaggaatgccgtggccgcgcgag
cccgacgcgctgaacatcctcaagcgggcgcttcgaaagctcgaccgagaggcgggcgaa
tcaaatcccctgttctacgtcagcgcggagtccggtgccggcgcgaccaccttcatccgc
aacttggcctgggaaaccgcgagcgaggggtatccgacgctcctggctgcggcggcgcct
tttacaccgagcagtgtcgaagtcacctcgtatatgtcgcgttgtatggaaacggccaca
aagacggggatcggggcggacacgcgtctctatcaggctccttggctgatcgtcttcgac
cgcaccgccttgaacggccacgaggatgacctgatccatttctcgcgcgagcttgaaaag
agcgggcgccgggcgtgcatcgtgttcgtcacggacagcgtcctgccgatcgcgatttat
gaaggaagccggtttaaacgcttggcggtcctgacccatcaggtgtcgaagccggacgct
gtagaattgggacggcacctcaaccgatatttgctgaaacatggaacggtccggtcggaa
gctgagtggaacaacttccttcagcgctcaatcgttggcccggggaatggctatgccgcc
ttctggatcgcgctgtcgttctggctccggcgcctgttcgacatggaagaaaccatccag
tcctggctctactatcagtttcacgagaaagtcaccgatccagttcttcgccacgccatc
atcgatatcgctgcgatgagcaccgttcaccggccgctgccagaggtactgctgcccgcc
tcgcacgattggccgaccgcggacaagctgtgcgacattcagtccgggctcggcgccctc
ggcatcgtgcggggcatcgatagcactcagcgctactgggcgctcattcatgacctgctt
ggccgtttcctgttgacggcgcttttctatgaccgccctgcactcgaagccgcgggattt
ggggaggccaccaaccctgagcatctccggctactcgtattgaagcggattgcccgcctg
cccggccttgcacacaggggcctgcgtgaggtagctgaagcgttcgccacctccattttc
aaaattgaccccagccatgggcatgcgctgtttgccccctactggcgggaggctctggtg
gcgttggacgagatgccccgtgcctttcggacaacaagccgggcatttctccatcatgcc
gcgatctcgcgtcgacgcattgccaaggataagtccgctttcgatatttcggacgacgag
cgggcggagttgctttcgcgcgccatctcggacattgaaacggccctcagcatcaccggt
gacgccgacggcgaatccgacatgaatctgctgaactctctcgcccacgcctatcatgac
ttggccgaggtcgaggtgcagcgccgcgctaagcaagagcgtatccaggatctgcagacg
aaggcacgggatgcgacgcgacgcgcctaccggctcagccccgacaattcattcgttgta
gaaacgtacgcgcgcgaccttctgaccggcgcccgcagcgacccgacggccaccgcgggc
aatgcgatcgaagttttggggctcgtgtatgctgcgatgcagcgtggcgccgccgaggca
cgccgtttcgcgctcgggcggctggctgaggccgcactcgacgtcctcttggaagtagcc
ggcgaattcgacgaaaggagcaacccacagaccgaaagcgacgcgatcatcgttgcactt
aaatcactggcggaaggcgtacgtcgtttcgaagggatggaactcaacgattatccggcc
accaatcgcatcagagcggcggaacatctcgcaaacccaatcttgcgaagcaacgctcag
gccgtgcgccttcaatacctcctctgctgcatggatcgccctcaggattttgctcagcag
cttgaatttttggagtcccttaaggggagttccagcactttcactccgcagatggacctt
gaacttgctgtgcttctgcaccagcgcgaccggcatcacgaagcggcccgcaagttccac
gagcttcgccaacgttggcagcgggaggaacacttcgtcgaggtgccggagcggctgaag
tggctgcgtgtgcgcgacagggatgatcgccggcaggtgcgcgcacgcatcagccagacc
ggcgacggccgtcaccgcgccagggtcagcgaaatgcagggcgtagaggtcactttccgg
ccccaggaattcggccgggagaaacttcgaccaggaatggttattaatggatatatctcc
ttcggccacaacggcccgttcctgcggcccctgacggcgaactga

DBGET integrated database retrieval system