KEGG   Rhodospirillum centenum: RC1_0058Help
Entry
RC1_0058          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
46375..46572
Genome map
AA seq 65 aa AA seqDB search
MRMTPRGFGGDRTPPEAIKRDGWQAQGILVVSENDQRLTWPDRELVRQLGRKLYGDRPAK
EARHG
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgacgcccagaggcttcggcggcgaccgcacgccaccggaagccatcaagcgc
gacggctggcaggcccagggcatcctggtggtcagcgagaacgaccagcgactgacctgg
ccggatcgcgaactggtccgccagctcgggcggaagctctacggcgaccggccggcgaag
gaggcccgccatggctga

DBGET integrated database retrieval system