KEGG   Rhodospirillum centenum: RC1_0059Help
Entry
RC1_0059          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
46565..47017
Genome map
AA seq 150 aa AA seqDB search
MADPRWTPLMVEERLTEAADVLKRLPERRIGGYFNTWPQIVPEFCDLVGREPPQLRPPLP
TAAAITRMEETLGWTIGLDPVDARIVWLRAGGERWKEVCWKVGLARAAAHQHWLYALCVI
AWRLNGRRVPGKRSRQQVIAMVRAACGSAG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctgatccccgctggaccccgctgatggtcgaggagcggctgaccgaggcggccgac
gtgctgaagcgcctgcccgagcggcgcatcggcggctacttcaacacttggccgcagatc
gtgccggagttctgcgatctggtcgggcgcgagccgccccagcttcgcccgccgctgccc
accgccgccgccatcacccgcatggaggaaacccttggctggaccatcgggctcgatccg
gtggatgcccggatcgtctggctgcgggccggcggcgaacgctggaaggaggtatgctgg
aaggtcggtctggcgcgcgccgccgcccatcagcattggctctacgcgctctgcgtcatc
gcctggcgtctcaacgggcggcgggtgccgggcaagcggtcgcgccagcaggtgatcgcg
atggtccgtgcggcgtgcggcagcgcagggtag

DBGET integrated database retrieval system