KEGG   Rhodospirillum centenum: RC1_0063Help
Entry
RC1_0063          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(51064..51594)
Genome map
AA seq 176 aa AA seqDB search
MTTLSDLTLTQLATAYGALSGTETGPKTFNSKARAISRLEALLAERGLTIADALRAAGIA
ADVAFDDSGCDPEPAGASGGDDRPGADLEAAVTAIEETLAAEPPRTKRSRADSKQAQMIA
LLRRPEGTTIAEIAAATGWQAHTVRGFFAGALKKKLGLTVTSEKVEERGRVYRIAP
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacgactttgtccgacctgaccctgacccagctcgccaccgcctatggcgccctgtcc
ggcaccgagaccggaccgaagactttcaacagcaaggccagggcgatcagccggctggag
gcgctgctggccgagcgcggcctgaccatcgccgacgccctgcgcgccgccgggatcgcg
gccgacgtggccttcgacgacagcggctgcgatcccgagccggccggcgccagcggcggg
gacgaccgccccggcgccgacctcgaggcggcggtgaccgccatcgaggagacgctcgcc
gccgaaccgccgcgcaccaagcgcagccgcgccgacagcaaacaagcgcagatgatcgcc
ctgctccgccggccggaagggaccaccatcgcggagatcgcggcggccaccggctggcag
gcccacacggtgcgcgggttctttgccggggcgctgaagaagaagctcggcctcaccgtg
acgtcggagaaggtcgaggaacgcgggcgggtctacaggatcgccccctga

DBGET integrated database retrieval system