KEGG   Rhodospirillum centenum: RC1_0064Help
Entry
RC1_0064          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(51695..51946)
Genome map
AA seq 83 aa AA seqDB search
MTVRTTMEDAMPTPRDNTQALDAFLARKAEIDTMLARLAALSADHFNVAPDDIHWGHVGT
LATYAELLKRITDAAFREGEHAD
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccgcaccacgatggaggatgcgatgcccacgccccgcgacaacacccaggcc
ctggacgccttcctggcccgcaaggccgagatcgacacgatgctggcgcggctggcggcg
ctcagcgcggaccacttcaacgtcgcgcccgacgacatccactggggccatgtcggcacc
ctggccacctacgccgagcttctcaagcgcatcaccgacgccgccttccgcgagggcgaa
cacgccgactga

DBGET integrated database retrieval system