KEGG   Rhodospirillum centenum: RC1_0066Help
Entry
RC1_0066          CDS       T00785                                 

Definition
(GenBank) phage terminase large subunit (GpA)
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
52465..54471
Genome map
AA seq 668 aa AA seqDB search
MRRRRSPSPLRLTGHPGLAKLVTTALQMLTPPPDLTVSQWADANRRLSSEASAEPGRWST
ARAEYQRGIMDAVSDPDIETVVVMSSAQVGKTEVLNNTVGYHIDQDPSPIMVVMPTERDA
ETWSKDRFAPMARDTPCLIGRIADPKSRDGSNKILHKRFAGGHLTIVGANAPSGLASRPI
RILLCDEVDRYPASAGAEGDPVKLARKRTVTFWNRKILLVSTPTLKGASRIETAFEESDR
RRFWVPCPDCGQHQVLSWGQVRWDSDPEPRPDSARYVCVHCDAVWGDARRWQAISRGQWR
AEAPFTGIAGFHLNEIYSTWVRLADMVRTFLSAKAAGDEAMKTFVNTSLGETWQESGEAP
DWQRLYERRGGYRFGAVPTGGLFLTAGADVQKDRIEVSVWAWGRGLTSWLVDHVVIEGGP
ERAEAWAALTALLGRTWPHTHGSRLGLARLAIDTGYEAPAVYAWARSVGFAQVAPVKGVE
GFNRAAPVAGPSYVDATENGRKVRRGARLWTVAVATFKSETYRFLRLARPTDEDLAAGIT
VPPGSLHLPQGVEAEWVKQLVAEQLVTVKTKRGFTKLDWQKLRERNEALDCRVYARAAAW
IAGIDRWTEAKWRDLEDQVGPAPDAAGTPTPVVPAAEVPTAGHLKRPTAPGEKRRGGWLG
GRNQGWLG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
ttgcggcgacgccggtcgccgtcgcccctgcgcctgaccgggcatccggggctggcgaag
ctggtgacgacggcgttgcagatgctgacgccgccgccggacctgacggtgagccaatgg
gcggacgccaaccgccggctgagttctgaggccagcgccgagccgggccgctggtccacc
gcccgggccgaataccagcgcggcatcatggatgccgtttccgacccggatatcgaaacc
gtggtggtgatgtcgtcggcccaggtgggcaagacggaggtgctgaacaacacggtcggc
taccatatcgaccaggatccgtcgccgatcatggtggtgatgcccaccgagcgcgacgcg
gagacctggtcgaaggaccgtttcgcgcccatggcacgggacacgccgtgcctgatcggg
cggatcgccgaccccaagtcgcgtgacggttccaacaagatcctgcacaagcggtttgcc
ggcggccacctgaccatcgtcggggccaacgcgccgtcggggctggccagccggccgatc
cgcatcctgctctgcgacgaggtcgaccgctacccggctagcgccggggctgaaggcgac
ccggtcaagctggcgcgcaagcgcaccgtcaccttctggaaccgcaaaatcctgctggtc
tcaaccccgaccctgaagggggccagccggatcgaaacggcgttcgaggaaagcgaccgc
cgccgcttctgggtgccgtgcccggattgcggccagcatcaggtgctgagctgggggcag
gtgcgctgggacagcgacccggaaccccggccggacagcgcccgctatgtctgcgtccat
tgcgatgccgtctggggtgatgcccggcgctggcaggcgatatctcgcgggcagtggcgg
gcggaggcgccgttcaccggcatcgccggtttccacctcaacgagatctattccacctgg
gttcggctggccgacatggtgcgcacctttctgtcggccaaggccgccggcgacgaggcg
atgaagaccttcgtcaacacctcgctgggcgagacctggcaggagagcggcgaagcgccg
gactggcagcgtctctatgaacgacgcggcggctaccgcttcggcgcggtgcccacgggc
ggcctgttcctcaccgccggggccgacgtgcagaaggaccggatcgaggtgtcggtgtgg
gcctgggggcgcgggctgaccagctggctggtggaccatgtcgtcatcgagggcgggccc
gaacgggcggaggcctgggcggcgctgacagcattgctgggccggacatggccacacacc
catggcagccggctggggctagcgcggctggccatcgataccggctatgaggcacccgcc
gtctatgcctgggccaggagcgtgggtttcgcgcaggtggccccggtcaaaggggtggag
ggcttcaacagggcggcgcccgtcgccggccccagttacgtggatgccaccgagaatggc
cgcaaggtgcggcgcggggcgcggctgtggacggtggccgtggccaccttcaagagcgaa
acgtaccgtttcctgcggttggcccggcctacagacgaggacttggccgccggcatcacc
gtgccccccggcagcctgcacttaccgcagggcgtggaggccgaatgggtcaagcagctt
gtggccgagcagctggtgacggtgaagaccaagcgcggcttcaccaaactggactggcag
aagctgcgcgagcgcaacgaggcgctggactgccgcgtctatgcccgcgccgccgcctgg
atcgccggcatcgaccgctggaccgaggcgaagtggcgcgatctggaggatcaggtcggg
ccggcgcccgacgccgctggaaccccaaccccggtggtgccggccgctgaggttccgacc
gccggtcaccttaaacgccccaccgcaccgggggagaaacgccggggcggctggttgggt
ggacgcaatcagggttggttgggatga

DBGET integrated database retrieval system