KEGG   Rhodospirillum centenum: RC1_0112Help
Entry
RC1_0112          CDS       T00785                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RC1_0112 (tpiA)
   01230 Biosynthesis of amino acids
    RC1_0112 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_0112 (tpiA)
   00051 Fructose and mannose metabolism
    RC1_0112 (tpiA)
   00562 Inositol phosphate metabolism
    RC1_0112 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_0112 (tpiA)
Enzymes [BR:rce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RC1_0112 (tpiA)
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RC1_0112 (tpiA)
  Exosomal proteins of bladder cancer cells
   RC1_0112 (tpiA)
  Exosomal proteins of melanoma cells
   RC1_0112 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98520..99275
Genome map
AA seq 251 aa AA seqDB search
MPDRRPLIAGNWKMNGLRADGTALARDLAGRLAAAGSAGFDLLVCPPATLLHAVGEALAG
SGIALGGQDCHAAEKGAHTGDVSAWMLADIGCSHVIVGHSERRHDHGEDDAAVRAKAAAA
HKAGLTAIICVGETEAERDAGEAEAVVARQLEGSIPQGADAVDTVIAYEPVWAIGTGRTP
TVADIAAMHGMIRRRLHGLVASPDSVRILYGGSMKPGNAAEIMAVADVDGGLVGGASLKA
DDFWQIALSVR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccgccgcccgttgatcgccggaaactggaagatgaacggcctgcgcgccgac
ggaaccgccctggcccgggatctggccgggcggctcgcggcggccgggtcggcaggtttc
gatctgctggtctgtccgcctgcgacacttcttcacgccgtcggcgaggccctggccggg
agcgggatcgccctgggcggccaggactgccatgcggcggagaagggcgcccacacgggc
gacgtcagcgcctggatgctggcggacatcgggtgcagccacgtcatcgtcggccattcc
gagcgccgccacgaccacggggaggacgacgccgccgtgcgcgccaaggccgcagcggcg
cacaaggcgggcctgaccgccatcatctgcgtcggtgagacggaggccgagcgcgatgcg
ggcgaggccgaggctgtcgtcgcccgccagctcgaagggtcgatcccgcagggtgctgac
gcggtcgacacggtcatcgcctacgagcccgtctgggcgatcggcaccgggcggaccccg
acggtcgccgacatagcggccatgcacggcatgatccgccgtcggctccacgggctggtt
gccagccccgattccgtgcgcatcttgtatggcggttcgatgaagcccggaaacgccgcc
gaaatcatggccgtggccgatgtggacggtggtctggtcggtggcgccagcctgaaggcg
gacgatttctggcagatcgccctgtccgtccgatag

DBGET integrated database retrieval system