KEGG   Rhodospirillum centenum: RC1_0112Help
Entry
RC1_0112          CDS       T00785                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rce00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rce00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rce00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rce00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98520..99275
Genome map
AA seq 251 aa AA seqDB search
MPDRRPLIAGNWKMNGLRADGTALARDLAGRLAAAGSAGFDLLVCPPATLLHAVGEALAG
SGIALGGQDCHAAEKGAHTGDVSAWMLADIGCSHVIVGHSERRHDHGEDDAAVRAKAAAA
HKAGLTAIICVGETEAERDAGEAEAVVARQLEGSIPQGADAVDTVIAYEPVWAIGTGRTP
TVADIAAMHGMIRRRLHGLVASPDSVRILYGGSMKPGNAAEIMAVADVDGGLVGGASLKA
DDFWQIALSVR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccgccgcccgttgatcgccggaaactggaagatgaacggcctgcgcgccgac
ggaaccgccctggcccgggatctggccgggcggctcgcggcggccgggtcggcaggtttc
gatctgctggtctgtccgcctgcgacacttcttcacgccgtcggcgaggccctggccggg
agcgggatcgccctgggcggccaggactgccatgcggcggagaagggcgcccacacgggc
gacgtcagcgcctggatgctggcggacatcgggtgcagccacgtcatcgtcggccattcc
gagcgccgccacgaccacggggaggacgacgccgccgtgcgcgccaaggccgcagcggcg
cacaaggcgggcctgaccgccatcatctgcgtcggtgagacggaggccgagcgcgatgcg
ggcgaggccgaggctgtcgtcgcccgccagctcgaagggtcgatcccgcagggtgctgac
gcggtcgacacggtcatcgcctacgagcccgtctgggcgatcggcaccgggcggaccccg
acggtcgccgacatagcggccatgcacggcatgatccgccgtcggctccacgggctggtt
gccagccccgattccgtgcgcatcttgtatggcggttcgatgaagcccggaaacgccgcc
gaaatcatggccgtggccgatgtggacggtggtctggtcggtggcgccagcctgaaggcg
gacgatttctggcagatcgccctgtccgtccgatag

DBGET integrated database retrieval system