KEGG   Rhodospirillum centenum: RC1_0617Help
Entry
RC1_0617          CDS       T00785                                 

Gene name
murF
Definition
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (EC:6.3.2.10)
Orthology
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
rce  Rhodospirillum centenum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rce00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rce00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(655478..656956)
Genome map
AA seq 492 aa AA seqDB search
MKTHDGSDILWTAADAAAATNGRHPTGRTPGHWMATGVSIDSRTLRPGDLFVALKGPNFD
GHDYVGDALAHGAAAALVSRLPGNVPPEAPVLLVDDTLAALEDLGRVARLNARGKVIAVT
GSVGKTGTKEALKLCLDARGPTFATQGSLNNHWGVPLSLARFPADAHYGVFELGMNHAGE
IGPLSRMVQPDVAIITTVEAVHLEFFASVEGIADAKAEIFEGMTPAGTAILNRDNPHFAR
LVAAARTQGLTRIWSFGTQEGADAHLLECSLHATSSAVTASIRGERIQYCLSLPGRHHVL
NSLAVLLAVSAAEGDVAAAARQLSQIAPIKGRGLRRRVALAKGSFTVIDESYNASPVSVA
AAATVLGKADPGAGGRRIAVLGDMLELGAQAPSLHAGLADQFRRAGADLVFCCGPNMKFL
FDRLPAALRGRHTEDSAALAPLVADAVRAGDVVMVKGSAGSRMSRVVDALVALDHGDQAA
EAPAAVAAGSAS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcacgacggctccgacatcctgtggacagcggctgatgccgccgccgcgacc
aacggccgccatccgaccgggcgcaccccggggcactggatggcgacaggcgtctccatc
gacagccgcacgctccggcccggcgacctgttcgtcgcgctgaagggccccaacttcgac
ggccacgactatgtcggcgacgcgctggcgcacggggccgcggcggccctggtctcccgc
ctgccgggcaacgtgccgcccgaggcgccggtgctgctggtggacgacaccctggccgcg
ctggaggatctggggcgcgtcgcccgcctgaacgcccgcggcaaggtcatcgccgtcacc
ggatcggtcggcaagaccgggacgaaggaggcgctgaagctctgcctggacgcccggggg
ccgaccttcgccacccagggcagcctgaacaaccactggggcgtgccgctgtcgctggcc
cgctttcccgccgacgcgcactacggcgtcttcgagctgggcatgaaccatgccggggag
atcgggccgctgtcccgcatggtgcagccggacgtggcgatcatcaccacggtggaggcg
gtgcatctggagttcttcgccagcgtcgagggcatcgccgacgccaaggcagagatcttc
gagggcatgacgccggccggcaccgccatcctgaaccgcgacaacccgcatttcgcccgg
ctggtcgctgccgcccgcacccagggcctgacccggatctggagcttcggcacgcaggag
ggcgcggacgcgcaccttctggagtgctcgctgcacgccacctcctccgccgtcacggcc
agcatccggggcgagcgcatccagtactgcctgtccctgcccggccggcaccatgtcctg
aacagtcttgcggtgctgctggccgtcagcgcggccgagggcgacgtggccgccgcggcg
cggcagctctcccagatcgccccgatcaagggccgtggcctgcgccgccgggtggccctg
gccaagggcagcttcaccgtgatcgacgagagctacaacgccagccccgtctccgtcgcc
gccgcagccaccgtgctcggcaaggccgatcccggcgccggcggccgccgcatcgccgtg
ctgggcgacatgcttgaactgggcgcgcaggcgccctcgctgcatgccgggctggccgac
cagttccgccgcgcgggcgccgatctggtgttctgctgcggcccgaacatgaagttcctg
ttcgaccgcctgcccgccgccctgcgcggccgccataccgaggacagcgcggcgctggcg
ccgctggtggcggacgcggtgcgggcgggcgacgtggtgatggtgaaaggatcggccggc
agccgcatgagccgggtggtcgatgcgctcgtcgcgctcgaccacggggatcaggcggcg
gaggcaccggccgcggtcgccgccggttcggcgagctga

DBGET integrated database retrieval system