KEGG   Rhodospirillum centenum: RC1_1027Help
Entry
RC1_1027          CDS       T00785                                 

Definition
beta-glucosidase-like protein (EC:3.2.1.21)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rce  Rhodospirillum centenum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RC1_1027
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    RC1_1027
Enzymes [BR:rce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RC1_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091410..1092459
Genome map
AA seq 349 aa AA seqDB search
MSAASSSSEPPRRPLAVAFGCAGPDLTAQERAFFREADPFGFILFRRNAETPEQVRRLTG
DLRDAVGRDAPVLIDQEGGRVARLRPPHWPEFPAARRIGDLAERDPEAGARAAWLDGRLL
AHMLADVGIDVDCAPVADLPVPGSHDVIGDRAFGADPGLVARLARAQAEGLLAGGVLPVV
KHLPGHGRASADSHRELPVVTAERAVLEATDFAPFRALSDLPCGMAAHVVYTAVDPAMPA
STSAAVIRTVIRGWIGFQGLLFSDDLSMQALSGGPGERARAVLAGGCDVALHCNGVLAEM
LEIAAAAPHLSEAGAVRWGRAAALRDAVEPADAGALRREFDALLAARIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgcatcatcgtcaagtgagcccccgcgtcggccgctggcggtcgccttcggc
tgcgccggccccgacctgacggcgcaggagcgggccttcttccgtgaggccgatcccttc
gggttcatcctgttccgacgcaatgcggagacgccggagcaggtccgccgcctgaccggc
gacctgcgcgatgccgtgggccgcgacgcccccgtcctgatcgaccaggagggcgggcgt
gtggcccggctgcgcccgccgcactggccggagttccccgcagcccgccgcatcggcgat
ctggcggagcgcgacccggaggcgggcgcacgcgcggcctggctggacggccgcctgctg
gcgcacatgctggccgatgtcggcatcgacgtggactgcgcacccgtggccgacctgcct
gtgccggggtcgcatgacgtgatcggcgaccgtgccttcggtgccgatccggggctggtc
gcccggctggcgcgggcgcaggcggaggggctgctggccggcggcgtcctgccggtggtg
aagcacctgccgggccacggacgggccagtgccgacagccacagggaactgccggtggtg
acggcggagcgggcggtgctggaggcgacggatttcgcccccttccgggcgctttccgat
ctgccctgcgggatggcggcccatgtcgtctacaccgccgtcgatccggccatgccggcc
agcacctcggccgcggtgatcaggaccgtcatccggggctggatcggcttccaggggctg
ctgttcagcgacgacctgtccatgcaggcgctcagcggtggcccgggcgagcgggcccgg
gccgtgctcgccggcggctgcgatgtcgccttgcactgcaacggcgttcttgcggagatg
ctcgaaatcgcggccgcggctccccatctgagtgaggccggtgccgtgcgctggggccgc
gcggcggccctgcgcgatgcggtcgaaccggccgatgccggtgccctgcgccgggagttc
gacgccctgctggccgcgcggatcgcctga

DBGET integrated database retrieval system