KEGG   Rhodospirillum centenum: RC1_1036Help
Entry
RC1_1036          CDS       T00785                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase, putative (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rce  Rhodospirillum centenum
Brite
Enzymes [BR:rce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RC1_1036 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098697..1099362
Genome map
AA seq 221 aa AA seqDB search
MSTAARKIRLLMLLRRNGVSDTGVLRAIEMIPREVFVPPTFHDQAYEDTALPIGHGQTIS
QPLVVGLMTQVLDLHDRLRVLEIGTGSGYQAAVLSRIVRRVYTIERHRPLLMEAERRFNT
LRLHNITARLGDGMRGWPEAAPFERILVTAGGGAEPPADLVKQLAVGGVMVIPLGPDRRE
QRVVRLRRTESGLAREDLWPVRFVPLLPDVAPEAPRAERAS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggccgcccgcaagatccggctgctgatgctgttgcgccgcaacggtgtcagc
gataccggcgttctgcgggcgatcgagatgatcccgcgtgaggtgttcgtgcccccgacc
ttccacgatcaggcctatgaggataccgccctgcccatcggccatggccagaccatcagc
cagcccctggtcgtgggactgatgacccaggtgctggacctgcacgaccgcctgcgggtg
ctggagatcggcacgggcagcggctatcaggcggcggtcctgtcccggatcgtccgccgg
gtctatacgatcgagcgccaccgtcccctgctgatggaggccgagcggcggttcaacacc
ctgcgcctgcacaacatcaccgcccgtctgggcgacgggatgcgcggctggcccgaagcg
gcgccgttcgagcgcatcctggtgaccgccggcggcggtgccgagccgccggcggacctg
gtgaagcaactggccgtcggcggggtcatggtgatcccgctggggccggaccgccgggag
cagcgggtcgtccgtctgcgccggacggagagcgggctggcgcgcgaggatctgtggccc
gtccgcttcgttccgctgctgccggacgtggctcccgaagcgccccgcgccgagcgggct
tcctga

DBGET integrated database retrieval system