KEGG   Rhodospirillum centenum: RC1_1353Help
Entry
RC1_1353          CDS       T00785                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rce  Rhodospirillum centenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rce00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393523..1394581
Genome map
AA seq 352 aa AA seqDB search
MPHDPAHHDDHHSHPHEPAPPPVGAYPRIRMRRNRADAWTRRMVSENRLTADDLIWPVFI
LPGENRREPVPSMPGVERLSIDLLVPAVAEAAELGIPCVALFPANPPEVKDPMGRESANP
DNLMCRAMRALKRQVPDIGLFGDVALDPYTSHGHDGILRDGRIVNDETVEVLVRQALVQA
DAGCDIVGPSDMMDGRIGAIREALDAHGHQGVRICAYSAKYASAFYGPFRDAVNTGALLT
GDKKTYQMDPANSDEALREVQLDLQEGADMVMVKPGLPYLDIIRRVKDTFRVPTLAYNVS
GEYAMLKAAAANGWLNYDKAMLEMLLAFKRSGADAVLTYAAIEAAKLLRQQG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgatcccgcccatcacgacgatcaccactcccacccgcacgagccagcaccg
ccccccgtcggcgcctatccgcgcatccggatgcgccgcaaccgcgccgacgcctggacc
cggcgcatggtttcggagaaccggctgacggcggatgacctgatctggccggtcttcatc
ctgcccggcgagaaccggcgcgaaccggtgccctccatgcccggcgtggagcggctgtcc
atcgacctgctggtgcccgcggtggccgaggcggccgagctgggcatcccctgcgtcgcc
ctgttcccggccaacccgcccgaggtcaaggacccgatgggccgggaatcggccaacccc
gacaatctgatgtgccgggcgatgcgcgccctgaagcggcaggtgccggacatcggcctg
ttcggcgacgtggcgctggacccctataccagccacggtcatgacggcatcctgcgcgac
ggccggatcgtcaacgacgagacggtcgaggtcctggtccgccaggctctggtccaggcc
gatgccggctgtgacatcgtcggccccagcgacatgatggacggccgtatcggcgccatc
cgcgaggcactggacgcgcacggccaccagggcgtgcgcatctgcgcctattcggccaag
tacgcctcggccttctacggtccgttccgcgacgccgtgaacaccggcgcgctgctgacc
ggcgacaagaagacctatcagatggacccggccaattccgacgaagccctgcgggaggtc
cagctcgacctccaggagggagcggacatggtcatggtgaagccgggcctgccctacctc
gacatcatccggcgcgtgaaggacaccttccgcgtcccgacgctggcctacaatgtcagc
ggcgagtacgcgatgctgaaggccgccgccgccaacggctggctgaactacgacaaggcg
atgctggagatgctgctggccttcaagcggtccggcgccgacgcggtgctgacctacgcc
gccatcgaggccgcgaagctgctgcgccagcagggatga

DBGET integrated database retrieval system