KEGG   Rhodospirillum centenum: RC1_1353Help
Entry
RC1_1353          CDS       T00785                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rce  Rhodospirillum centenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RC1_1353 (hemB)
Enzymes [BR:rce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RC1_1353 (hemB)
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC1_1353 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393523..1394581
Genome map
AA seq 352 aa AA seqDB search
MPHDPAHHDDHHSHPHEPAPPPVGAYPRIRMRRNRADAWTRRMVSENRLTADDLIWPVFI
LPGENRREPVPSMPGVERLSIDLLVPAVAEAAELGIPCVALFPANPPEVKDPMGRESANP
DNLMCRAMRALKRQVPDIGLFGDVALDPYTSHGHDGILRDGRIVNDETVEVLVRQALVQA
DAGCDIVGPSDMMDGRIGAIREALDAHGHQGVRICAYSAKYASAFYGPFRDAVNTGALLT
GDKKTYQMDPANSDEALREVQLDLQEGADMVMVKPGLPYLDIIRRVKDTFRVPTLAYNVS
GEYAMLKAAAANGWLNYDKAMLEMLLAFKRSGADAVLTYAAIEAAKLLRQQG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgatcccgcccatcacgacgatcaccactcccacccgcacgagccagcaccg
ccccccgtcggcgcctatccgcgcatccggatgcgccgcaaccgcgccgacgcctggacc
cggcgcatggtttcggagaaccggctgacggcggatgacctgatctggccggtcttcatc
ctgcccggcgagaaccggcgcgaaccggtgccctccatgcccggcgtggagcggctgtcc
atcgacctgctggtgcccgcggtggccgaggcggccgagctgggcatcccctgcgtcgcc
ctgttcccggccaacccgcccgaggtcaaggacccgatgggccgggaatcggccaacccc
gacaatctgatgtgccgggcgatgcgcgccctgaagcggcaggtgccggacatcggcctg
ttcggcgacgtggcgctggacccctataccagccacggtcatgacggcatcctgcgcgac
ggccggatcgtcaacgacgagacggtcgaggtcctggtccgccaggctctggtccaggcc
gatgccggctgtgacatcgtcggccccagcgacatgatggacggccgtatcggcgccatc
cgcgaggcactggacgcgcacggccaccagggcgtgcgcatctgcgcctattcggccaag
tacgcctcggccttctacggtccgttccgcgacgccgtgaacaccggcgcgctgctgacc
ggcgacaagaagacctatcagatggacccggccaattccgacgaagccctgcgggaggtc
cagctcgacctccaggagggagcggacatggtcatggtgaagccgggcctgccctacctc
gacatcatccggcgcgtgaaggacaccttccgcgtcccgacgctggcctacaatgtcagc
ggcgagtacgcgatgctgaaggccgccgccgccaacggctggctgaactacgacaaggcg
atgctggagatgctgctggccttcaagcggtccggcgccgacgcggtgctgacctacgcc
gccatcgaggccgcgaagctgctgcgccagcagggatga

DBGET integrated database retrieval system