KEGG   Rhodospirillum centenum: RC1_1560Help
Entry
RC1_1560          CDS       T00785                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rce  Rhodospirillum centenum
Pathway
rce00230  Purine metabolism
rce01100  Metabolic pathways
Module
rce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RC1_1560 (gmk)
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RC1_1560 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 CPT AAA_18 MMR_HSR1 cobW AAA_16 TsaE
Motif
Other DBs
NCBI-ProteinID: ACI98963
UniProt: B6IN66
Position
1607246..1607911
Genome map
AA seq 221 aa AA seqDB search
MSSTALTSDSTADRIRRRGLMLVLSSPSGAGKTTISRRLLEQNPDVAMSVSVTTRQKRPG
EVHGRDYFFIDPAEFNLMVNRGQLLEYAKVFDNYYGTPREAVEQSLRGGHDVLFDIDWQG
TQQLRETARTDLVSVFILPPSAHELERRLTTRAQDSAEEIARRMAKANDEMSHWSEYDYV
IVNHDIDDSVIAIQGILDTERLKRERQVGLSEFVRGLQAGF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaccgccctgacgtccgactcgaccgccgaccgcatccggcgtcgcggcctg
atgctcgtgctctcctccccctccggggcgggaaagaccaccatctcccgccggctgctg
gagcagaatcccgatgtcgccatgtcggtgtcggtcaccacgcggcagaagcggccgggc
gaggtgcatggccgggactacttcttcatcgacccggccgaattcaacctgatggtcaac
cgcgggcagcttctggaatacgccaaggttttcgacaactactacggcaccccccgggag
gcggtggagcagtcgctccgaggtgggcacgacgtgctgttcgacatcgactggcagggc
acccagcagctgcgcgagacggcgcgcacggacctcgtaagcgtcttcatcctgccgccc
tcggcgcacgagctggagcggcggctcaccacccgggcccaggacagcgccgaggagatc
gcccgccgcatggcgaaggcgaacgacgagatgagccactggtcggaatacgactacgtc
atcgtcaaccacgacatcgacgactcggtcatcgccatccagggcatcctcgacaccgag
cgcctgaagcgcgagcgtcaggtcgggctcagcgagttcgtgcgcgggctccaggccggg
ttctga

DBGET integrated database retrieval system