KEGG   Rhodospirillum centenum: RC1_1683Help
Entry
RC1_1683          CDS       T00785                                 

Gene name
pncA
Definition
pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rce  Rhodospirillum centenum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rce00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1729830..1730471
Genome map
AA seq 213 aa AA seqDB search
MTDRFVPAETDMLVLVDIQRDFCPGGALAVPDGDAVVPVANRLARRFAHVILTQDWHAPG
HRSFASAHPGRVPFEAVAMPYGTQVLWPDHCVQGTEGAEFHPGLDVPMAQAVIRKGFRPE
IDSYSAFSENDGRTPTGLAGLLRERGVRRCVFAGLALDFCVAFSAEDAVRCGFEALVVED
GCRAIDTGGSLASARARLATAGVRLIRSDGIGD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcttcgttccggccgagaccgacatgctggtgctggtggacatccagcgc
gacttctgccccggcggcgccctggccgtgccggacggcgatgccgtggtgccggtggcg
aaccggctggcccggcgcttcgcccatgtgatcctgacccaggactggcacgcgcccggc
caccgctccttcgccagcgcccatcccggccgggtgccgttcgaggcggtggcgatgccc
tacggcacccaggtgctgtggcctgaccactgcgtgcaggggacggaaggggcggagttc
caccccggcctggacgtgccgatggcgcaggcggtgatccgcaagggcttccgcccggag
atcgacagctattccgccttctccgagaacgacggccggacgccgaccgggctggccggc
ctgttgcgcgagcgcggcgtgcggcgctgcgtcttcgccgggctggcgctggatttctgc
gtcgccttctcggccgaggacgcggtgcgctgcggcttcgaggcgctggtcgtggaggac
ggctgccgcgccatcgacaccggcggctcgctggcgtccgcgcgggcgcggctggcgacg
gccggcgttcgcctgatccgcagcgacgggatcggagactga

DBGET integrated database retrieval system