KEGG   Rhodospirillum centenum: RC1_1743Help
Entry
RC1_1743          CDS       T00785                                 

Gene name
fadJ
Definition
fatty acid oxidation complex alpha subunit (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rce  Rhodospirillum centenum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RC1_1743 (fadJ)
   01212 Fatty acid metabolism
    RC1_1743 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RC1_1743 (fadJ)
   00650 Butanoate metabolism
    RC1_1743 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    RC1_1743 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    RC1_1743 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RC1_1743 (fadJ)
   00310 Lysine degradation
    RC1_1743 (fadJ)
   00380 Tryptophan metabolism
    RC1_1743 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RC1_1743 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RC1_1743 (fadJ)
   00281 Geraniol degradation
    RC1_1743 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RC1_1743 (fadJ)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RC1_1743 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RC1_1743 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RC1_1743 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1791723..1793909)
Genome map
AA seq 728 aa AA seqDB search
MTNAIAYAVDADGICTLTIDQPGRSMNVIDASFADEFAAAVDRAVADAAVKGVIVTSGKK
AFLAGADLMQLEARFEQAASLPVDQLFRQFFSFSAALRRMETSGKPFACALNGTALGGGF
EIALACHYRVAADDPSAKLGLPEVQVGLLPGAGGTQRVPRLIGIAAALPLLLEGRQLAPK
KALSTGLIHAVVPADQLLTAAKEWLTKSPNAVQPWDAKGYRVPGGAGGMDPKVIPVFMAG
NSMLREKTQGNYPAPAAIMSCVYEGTQLPIDTALRVEVKYFATLFRNPVARNMIRTLFIN
KGKADKLDRRPAGVPRTTFRRMGMLGAGMMGAGIAHVAAMAGIEVELIDQSQEAAEKGKG
YSAKLLADQVAKGRLTQEAADAILARIRPTTSYDGLADVDIVIEAVFEDRAIKADVTKRA
EAVMPATATFGSNTSTLPITGLAENSSRPAQFIGIHFFSPVDRMPLVEIIRGKATDDATL
ARALDFVQAIRKTPIVVNDARGFFTSRFCGTYINEGQTLLQEGVVPALIENAGKQAGMPV
GPLALADEVALDLSWKIRNQWKKDLGEQYRPASGEGVSDIMVEKLGRIGRKGRKGFYDYP
EGGKKRLWAGLGEVWPQRPEADQPDVDEVRKRLLYAQALDAVRCLEEGVLTDPADGDVGA
ILGLGYAPYTGGPLSMIDTIGVARFVAECDALAQKYGERFSPPTLLRDMAAEGRSFYGSG
SAARVAAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgccatcgcctacgccgtcgatgccgacggcatctgcaccctgaccatcgac
cagcccggccggtcgatgaacgtgatcgacgcctccttcgcggacgaattcgccgctgcc
gtggaccgcgccgtggccgatgccgcggtgaagggggtcatcgtcacgtccggcaagaag
gccttcctggccggggccgacctgatgcagctcgaagcccgcttcgagcaggcggcgagc
ctgccggtggaccagctcttccggcagttcttcagcttctccgccgccctgcggcggatg
gagacgagcggcaagcccttcgcctgcgccctcaacggcaccgccctgggcggcgggttc
gagatcgcgctggcctgccactaccgcgtcgcggcggacgatccctcggccaagctcggc
ctgccggaggtgcaggtcggcctgctgccgggggcgggcggcacccagcgcgtgccgcgc
ctgatcggcatcgcggcggcgctgccgctgctgctggaggggcgccagctcgcgccgaag
aaggcgctgtccacgggcctgatccatgccgtcgtgccggccgaccagctcctgaccgcg
gcgaaggaatggctgacgaagagcccgaacgccgttcagccctgggacgccaagggctac
cgggtgccgggcggcgccggcggcatggacccgaaggtgattccggtcttcatggccggc
aattccatgctgcgggagaagacccagggcaactacccggccccggccgccatcatgtcc
tgcgtctacgagggcacccagcttccgatcgacacggcgctgcgggttgaggtgaagtac
ttcgccacgctgttccgcaacccggtcgcgcgcaacatgatccgcaccctgttcatcaac
aagggcaaggcggacaagctggaccggcgcccggccggcgtgccgcggacgacgttccgc
cggatgggcatgctcggcgccggcatgatgggggcgggcatcgcccatgtcgcggccatg
gccgggatcgaggtggaactgatcgaccagagccaggaggcggcggagaagggtaagggc
tattctgccaagctgctggcggatcaggtcgccaagggccggctcacgcaggaggccgcg
gacgccatcctggcgcgcatccggcccaccacctcctatgacggtcttgccgacgtggac
atcgtcatcgaggcggtgttcgaggaccgcgccatcaaggccgacgtgacgaaacgtgcc
gaggcggtgatgccggccacggccaccttcggctccaacacctccaccctgccgatcacc
gggctggcggagaactcctcccgcccggcgcagttcatcggcatccatttcttctccccc
gtggaccggatgccgctggtggagatcatccgcggcaaggccacggacgacgcgacgctg
gcccgcgccctggacttcgtgcaggcgatccgcaagaccccgatcgtcgtcaacgatgcc
cgcggcttcttcacctcgcgcttctgcggcacctacatcaacgagggccagaccctgttg
caggagggagtcgtcccggccctgatcgagaatgccggcaagcaggccggcatgccggtc
ggcccgctggcgctggccgacgaggtcgcgctcgatctctcctggaagatccggaaccag
tggaagaaggatctgggtgagcagtaccgcccggcgtcgggcgagggcgtcagcgacatc
atggtcgagaagctgggccgcatcggccgcaagggccggaagggcttctacgattacccc
gagggcgggaagaagcggctctgggccgggctgggcgaggtctggccgcagcggccggag
gccgaccagccggacgtggatgaggtcaggaagcgcctgctctacgcccaggccctggac
gccgtgcgctgcctggaggaaggcgtgctgaccgacccggcggacggcgatgtcggtgcc
attctcgggctgggctatgcgccctacacgggcgggccgctctccatgatcgacacgatc
ggcgtcgcccgcttcgtggccgagtgcgacgcgctggcccagaagtacggcgagcggttc
agcccgccgaccctgctgcgcgacatggccgccgaaggccgcagcttctacggcagcggg
tccgccgcccgggtcgcggcggagtag

DBGET integrated database retrieval system