KEGG   Rhodospirillum centenum: RC1_1795Help
Entry
RC1_1795          CDS       T00785                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rce  Rhodospirillum centenum
Pathway
rce00790  Folate biosynthesis
rce01100  Metabolic pathways
Module
rce_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RC1_1795 (folP)
Enzymes [BR:rce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RC1_1795 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACI99192
UniProt: B6ITH4
Position
complement(1850096..1851253)
Genome map
AA seq 385 aa AA seqDB search
MTSTVPMTVPGAVPTLALLPPPVRPADLYLRPTAFLSGAEADRAVAAGQALRLAGSGFAF
ALLEVAVRTPEGSVRAIAPADAVRDWMAGLEPAAARRAAVLLAALTTPPLTVGEPAWAGL
GLGRPLIQGIVNVTPDSFSDGGDHADSAAAVAHGRALLEAGADILDVGGESTRPGAQPVD
PAEEAARVVPVIRALAEAGAVVSVDTRRASVMRSALAAGARIVNDITALAGDPDSLTVAA
AAGCPVVLMHMQGEPGTMQQDPQYRDVVLDVFDGLEERLLAAEAAGIPRHRIAVDPGIGF
GKTVEHNLALLRQVGIFHALGCPVLVGLSRKRFIASLSRGEEPKQRLPGSLAAGLATLSQ
GVQILRVHDVAETWQARAVWGSIGL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccgtgccgatgaccgtcccgggtgccgtgccgacccttgccctgcttccc
ccgccggtccgcccggccgacctctatctgcgtcccacggccttcctgtcgggggcggag
gcggaccgcgccgtcgcggcggggcaggcgctgcggctggccggcagcggcttcgccttc
gccctgctggaggtggcggtgaggactcccgagggcagcgtccgcgccatcgctccggcc
gacgccgtgcgcgactggatggccgggctggagccggcggcggcgcggcgtgccgccgtg
ctgctggccgcgctcaccacgccgccgttgaccgtgggtgagcccgcctgggccgggctg
gggctgggcaggccgctgatccagggcatcgtcaacgtcaccccggacagcttctccgac
gggggcgatcatgccgattccgccgccgcggtcgcgcacggccgggccctgctggaagcg
ggagcggacatcctggacgtgggcggcgagtcgacccggccgggcgcgcagccggtggac
cccgcggaggaagcggcccgggtcgtccccgtgatccgggcgctggcggaggccggcgcc
gtcgtctccgtggacacccgccgggcctcggtgatgcggtcggcgctggcggcgggcgcg
cggatcgtcaacgacatcacggccctggccggcgacccggacagcctcaccgtcgccgcg
gcggcgggctgccctgtcgtgctgatgcacatgcagggcgagccgggcaccatgcagcag
gacccgcagtaccgcgatgtcgtgctggacgtcttcgacgggctggaggagcggctcctg
gcggcggaggccgcgggcatcccgcgccaccgcattgccgtggaccccggcatcggcttc
ggcaagacggtggagcacaatctcgccctgctgcggcaggtggggatcttccacgcgctg
ggctgcccggtgctggtcgggctcagccgcaagcgcttcatcgccagcctgtcgcgcgga
gaggaaccgaagcagcgccttcccgggtcgctggccgccggtctggcgaccctttcccag
ggggtccagatcctgcgggtccacgatgtggcggaaacctggcaggcccgggcggtctgg
gggagcatcgggctatga

DBGET integrated database retrieval system