KEGG   Rhodospirillum centenum: RC1_1852Help
Entry
RC1_1852          CDS       T00785                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rce  Rhodospirillum centenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RC1_1852
   01230 Biosynthesis of amino acids
    RC1_1852
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_1852
   00030 Pentose phosphate pathway
    RC1_1852
   00051 Fructose and mannose metabolism
    RC1_1852
   00052 Galactose metabolism
    RC1_1852
  Energy metabolism
   00680 Methane metabolism
    RC1_1852
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RC1_1852
Protein phosphatases and associated proteins [BR:rce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RC1_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1907971..1909065
Genome map
AA seq 364 aa AA seqDB search
MTPTKRIGILTSGGDCAGLNAVIRAVVHRATTHYGWQVVGIEDGTQGLLSRPVRYLNLDL
NMVDGTMMRQGGTVLGTTNKGDPFAYPMADGSTRDRSQEIIGGLRELGVDTLIGIGGDGS
MAILRRLAAIGGIKLIGVPKTIDNDLGITETSVGFDTAVAVATEALDRLQPTAASHDRVM
VLEVMGRDAGHIALTAGIAGGADVILLPELSWSIEGVAAKIRQVQRNGRNFALVVVSEAV
KTAEGAAARKEFADGQKRYGGIGNYIGHLISEATGAETRVTVLGHVQRGCPPSYRDRLLA
SAFGVRAVDLIAEGKSDRLLAWSNRQVIDVPIEEAIAAYASVDTASTLVQTARGLGIYIG
DVDG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccaccaaacgcatcggcatcctcaccagcggcggcgactgcgccggcctgaac
gcggtcatccgggccgtggtccatcgggccaccacgcattacggctggcaggtcgtcggc
atcgaggacggcacccagggcctgctgtcgcgccccgtgcgctacctgaacctggacctc
aacatggtggacggcaccatgatgcggcagggcggcacggtgctgggcaccaccaacaag
ggcgaccccttcgcctatcccatggccgacggcagcacccgcgaccgcagccaggagatc
atcggcggcctgcgcgagctgggcgtggatacgctgatcggcatcggcggcgacggcagc
atggcgatcctgcgcaggctggccgccatcggcggaatcaagctgatcggcgtgcccaag
accatcgacaacgacctgggcatcaccgagacgtccgtcggcttcgatacggccgtcgcc
gtggcgacggaggcgctggaccggctccagcccaccgcagccagccacgaccgcgtcatg
gtgctggaggtgatgggccgcgatgccggccatatcgccctgaccgcgggcatcgccggc
ggcgccgacgtgatcctgctgcccgagctgtcctggtccatcgagggcgtggcggcgaag
atccggcaggtgcagcgcaacggccgcaacttcgccctggtcgtcgtctccgaagccgtg
aagacggccgagggcgccgccgcgcggaaggagttcgccgacggccagaagcgctacggc
ggcatcggcaactacatcggccatctgatctccgaggcgacgggggcggagacccgcgtc
accgtgctgggccatgtccagcgcggctgcccgccctcctaccgcgaccggctgctggcc
tcggccttcggcgtgcgcgccgtggacctgatcgcggagggcaagtccgaccggctgctg
gcctggtcgaaccgtcaggtgatcgacgtgccgatcgaggaggcgatcgccgcctatgcc
agcgtcgataccgccagcaccctggtgcagacggcgcgcggcctgggcatctatatcggc
gatgtggacggctga

DBGET integrated database retrieval system