KEGG   Rhodospirillum centenum: RC1_1852Help
Entry
RC1_1852          CDS       T00785                                 

Definition
(GenBank) 6-phosphofructokinase 1
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rce  Rhodospirillum centenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_1852
   00030 Pentose phosphate pathway
    RC1_1852
   00051 Fructose and mannose metabolism
    RC1_1852
   00052 Galactose metabolism
    RC1_1852
  Energy metabolism
   00680 Methane metabolism
    RC1_1852
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RC1_1852
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RC1_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1907971..1909065
Genome map
AA seq 364 aa AA seqDB search
MTPTKRIGILTSGGDCAGLNAVIRAVVHRATTHYGWQVVGIEDGTQGLLSRPVRYLNLDL
NMVDGTMMRQGGTVLGTTNKGDPFAYPMADGSTRDRSQEIIGGLRELGVDTLIGIGGDGS
MAILRRLAAIGGIKLIGVPKTIDNDLGITETSVGFDTAVAVATEALDRLQPTAASHDRVM
VLEVMGRDAGHIALTAGIAGGADVILLPELSWSIEGVAAKIRQVQRNGRNFALVVVSEAV
KTAEGAAARKEFADGQKRYGGIGNYIGHLISEATGAETRVTVLGHVQRGCPPSYRDRLLA
SAFGVRAVDLIAEGKSDRLLAWSNRQVIDVPIEEAIAAYASVDTASTLVQTARGLGIYIG
DVDG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccaccaaacgcatcggcatcctcaccagcggcggcgactgcgccggcctgaac
gcggtcatccgggccgtggtccatcgggccaccacgcattacggctggcaggtcgtcggc
atcgaggacggcacccagggcctgctgtcgcgccccgtgcgctacctgaacctggacctc
aacatggtggacggcaccatgatgcggcagggcggcacggtgctgggcaccaccaacaag
ggcgaccccttcgcctatcccatggccgacggcagcacccgcgaccgcagccaggagatc
atcggcggcctgcgcgagctgggcgtggatacgctgatcggcatcggcggcgacggcagc
atggcgatcctgcgcaggctggccgccatcggcggaatcaagctgatcggcgtgcccaag
accatcgacaacgacctgggcatcaccgagacgtccgtcggcttcgatacggccgtcgcc
gtggcgacggaggcgctggaccggctccagcccaccgcagccagccacgaccgcgtcatg
gtgctggaggtgatgggccgcgatgccggccatatcgccctgaccgcgggcatcgccggc
ggcgccgacgtgatcctgctgcccgagctgtcctggtccatcgagggcgtggcggcgaag
atccggcaggtgcagcgcaacggccgcaacttcgccctggtcgtcgtctccgaagccgtg
aagacggccgagggcgccgccgcgcggaaggagttcgccgacggccagaagcgctacggc
ggcatcggcaactacatcggccatctgatctccgaggcgacgggggcggagacccgcgtc
accgtgctgggccatgtccagcgcggctgcccgccctcctaccgcgaccggctgctggcc
tcggccttcggcgtgcgcgccgtggacctgatcgcggagggcaagtccgaccggctgctg
gcctggtcgaaccgtcaggtgatcgacgtgccgatcgaggaggcgatcgccgcctatgcc
agcgtcgataccgccagcaccctggtgcagacggcgcgcggcctgggcatctatatcggc
gatgtggacggctga

DBGET integrated database retrieval system